drome-dnlg1

 
Drosophila melanogaste (Fruit fly) Neuroligin

Comment
belongs to a cluster of sequences upstream of alpha-esterase cluster Old entries drome-CG12148 drome-CG31146 only central part Pfam A COesterase 135 710


Relationship
Family Neuroligin
Block C
Drosophila melanogaster position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > melanogaster group: N E > melanogaster subgroup: N E > Drosophila melanogaster: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 1 more: AE003671, BT011155, NM_169191
1 UniProt : Q6IKI9
2 Ncbi-pid : 7298788, 298789
3 UniProtTrembl : Q6NNX7, Q9VIC7, Q6IKI9
3 Interpro : Q6NNX7, Q9VIC7, Q6IKI9
3 Prodom : Q6NNX7, Q9VIC7, Q6IKI9
3 Pfam : Q6NNX7, Q9VIC7, Q6IKI9
3 PIRSF : Q6NNX7, Q9VIC7, Q6IKI9
3 SUPERFAM : Q6NNX7, Q9VIC7, Q6IKI9
3 QuickSwissBlast : Q6NNX7, Q9VIC7, Q6IKI9
1 FlyBase : 0037511
 
Sequence
Graphical view for this peptide sequence: drome-dnlg1
Colored MSA for Neuroligin (raw)
PERRHVVPDKLQYTQEIQVKQGRLMGITRRFQVTSGLRQVDQFLGLPYAE
APTGNRRFMPPGAPLPWQGLKIARHLPPVCPQKLPDLSPHGSENMSRARH
KHLSRLLPYLRTESEDCLYLNLYVPHEEPQSTPKQYAVLVYLHGESFEWN
SGNPYDGSVLSSYGEVIVVTVNYRLGVLGFLRPSIDAHNIANYALLDQIA
ALHWIKENIEAFGGDNSRVTLMGHSTGAACVNYLMVSPVASGLFHRAILM
SGSAMSDWAASNQSLQLTMQIAHALECPLNEHVEAEDDDVLLDCLRHRRY
QDILHIPTALTQFSTSLGPIVDGHVIPNQPYKVMGHYTEHFSRYDLLFGI
TESESYHTLAALALEEGLRENERDNLLRFYMQSRFDIRPDLALAATLKKY
QDMYNNPIKATNLEHRDVVLDILSDARVVGPLLQTGMFHADVNRRNYMYV
FGHNSATGPFAHLPHSIMGEELAFIFGAPLAAAGPFPSGNYTVQEKLLSE
AVMAYWTNFVKTGNPKAPWKGIFINSHALEWDRYDLDWPEFNRRAQAYLN
IGIPPTVGYKYRQIYMNFWNKELPDELNQIAAIQEQLQKPGQEVITGHMS
KYGPRDHGAEDPVRTLKLLLQEPSLAGPTQSGESTETAAENMYNAPPTFG
HVHKMQGGSDFEDLVTSTNSLESGEDHPQAPPETVAKSEATMQLLIALIT
IIIVLNLLIYGTFLLRQRRRRAKALPFPAPK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

PERRHVVPDKLQYTQEIQVKQGRLMGITRRFQVTSGLRQVDQFLGLPYAE
APTGNRRFMPPGAPLPWQGLKIARHLPPVCPQKLPDLSPHGSENMSRARH
KHLSRLLPYLRTESEDCLYLNLYVPHEEPQSTPKQYAVLVYLHGESFEWN
SGNPYDGSVLSSYGEVIVVTVNYRLGVLGFLRPSIDAHNIANYALLDQIA
ALHWIKENIEAFGGDNSRVTLMGHSTGAACVNYLMVSPVASGLFHRAILM
SGSAMSDWAASNQSLQLTMQIAHALECPLNEHVEAEDDDVLLDCLRHRRY
QDILHIPTALTQFSTSLGPIVDGHVIPNQPYKVMGHYTEHFSRYDLLFGI
TESESYHTLAALALEEGLRENERDNLLRFYMQSRFDIRPDLALAATLKKY
QDMYNNPIKATNLEHRDVVLDILSDARVVGPLLQTGMFHADVNRRNYMYV
FGHNSATGPFAHLPHSIMGEELAFIFGAPLAAAGPFPSGNYTVQEKLLSE
AVMAYWTNFVKTGNPKAPWKGIFINSHALEWDRYDLDWPEFNRRAQAYLN
IGIPPTVGYKYRQIYMNFWNKELPDELNQIAAIQEQLQKPGQEVITGHMS
KYGPRDHGAEDPVRTLKLLLQEPSLAGPTQSGESTETAAENMYNAPPTFG
HVHKMQGGSDFEDLVTSTNSLESGEDHPQAPPETVAKSEATMQLLIALIT
IIIVLNLLIYGTFLLRQRRRRAKALPFPAPK

no DNA




References
    Title: Drosophila neuroligin 1 regulates synaptic growth and function in response to activity and phosphoinositide-3-kinase
    Mozer BA, Sandstrom DJ
    Ref: Molecular & Cellular Neurosciences, 51:89, 2012 : PubMed

            

    Title: Drosophila neuroligin 1 promotes growth and postsynaptic differentiation at glutamatergic neuromuscular junctions
    Banovic D, Khorramshahi O, Owald D, Wichmann C, Riedt T, Fouquet W, Tian R, Sigrist SJ, Aberle H
    Ref: Neuron, 66:724, 2010 : PubMed

            

    Title: The genome sequence of Drosophila melanogaster
    Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA and Venter JC <185 more author(s)>
    Ref: Science, 287:2185, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer