drome-glita

 
Drosophila melanogaster (Fruit fly) CG3903 mRNA for gliotactin

Comment
Adhesion protein Nucleotide sequence of the Celera sequence differs from the published sequence for this transcript


Relationship
Family Gliotactin
Block C
Drosophila melanogaster position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > melanogaster group: N E > melanogaster subgroup: N E > Drosophila melanogaster: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 5 more: L39083, AE003648, AE003416
1 Ncbi-nid : 899061
2 Ncbi-pid : 7298250, 7287926
>3 UniProtTrembl links 1 more: Q9NK80, Q86LF3, Q7YU32
>3 Interpro links 1 more: Q9NK80, Q86LF3, Q7YU32
>3 Prodom links 1 more: Q9NK80, Q86LF3, Q7YU32
>3 Pfam links 1 more: Q9NK80, Q86LF3, Q7YU32
>3 PIRSF links 1 more: Q9NK80, Q86LF3, Q7YU32
>3 SUPERFAM links 1 more: Q9NK80, Q86LF3, Q7YU32
>3 QuickSwissBlast links 1 more: Q9NK80, Q86LF3, Q7YU32
1 FlyBase : 0001987
 
Sequence
Graphical view for this peptide sequence: drome-glita
Colored MSA for Gliotactin (raw)
MMHKLKYRDKLKWLLALLVLIGTCFIQTRGQTRDPRFYSRPGVDYHWPNP
GDPDYRTYTFNDRRYGHYQPNGYGANYPGRNPPGQYPQGMPNEDRFRFDP
NDPNARTQFPGVLAGWREDLQGKQRRDSLTLERDVFVTTNYGQVQGFKVY
MYDNPDPKSFYRPYHSTVDRVMGECSVFLGIPYALPPTFEGRFKPPRVHR
GWQLLQAVDFGPACPQPVRYTGATKGIMDMDEDCLYLNVYSPKTGAGVAQ
KYPVMVYIHGGEFIRGASNLFQGHILASFYDVVVVTLNYRLGALGFLSTG
DENSPGNYGILDQAMALRWVYDNIEFFNGDRNSITLFGPGAGGASAGLLM
VAPQTRNIVRRVIAQSGSALADWALIQDKYRAQNTSRVLGQLLGCSIESS
WKLVNCLRTGRSFYELGNAEFSPQVGSFPWGPVLDHNFTLPGDDWYEGWR
EKDWRFLTKTPETLIRAGKFNRNIQYMTGVTTQEAAFFVAQNESLSPYYE
LDGRFFDQKIREHVFRYNYTLNPNGVYEAIKYMYTFWPDPNNNTIIRDQY
INMLSDLYYRAPVDQMVKLMLEQKVPVYMYVLNTTVEALNLPQWRKYPHD
IERYFLTGAPFMDTEFFPKKEHLQRNMWTDNDRNMSHFFMQTYTNFARYG
NPTPQQVLGMHFQRAYQGEIRYLNINTTYNSSILLNYRQTECAFWTQYLP
TVIGVLVPTYPPTTEYWWEPKEPLQIAFWSMSVACFFLIVLVVICCIMWR
NAKRQSDRFYDEDVFINGEGLEPEQDTRGVDNAHMVTNHHALRSRDNIYE
YRDSPSTKTLASKAHTDTTSLRSPSSLAMTQKSSSQASLKSGISLKETNG
HLVKQSERAATPRSQQNGSIAKVASPPVEEKRLLQPLSSTPVTQLQAEPA
KRVPTAASVSGSSRSTTPVPSARSTTTHTTTATLSSQPAAQPRRTHLVEG
VPQTSV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMHKLKYRDKLKWLLALLVLIGTCFIQTRGQTRDPRFYSRPGVDYHWPNP
GDPDYRTYTFNDRRYGHYQPNGYGANYPGRNPPGQYPQGMPNEDRFRFDP
NDPNARTQFPGVLAGWREDLQGKQRRDSLTLERDVFVTTNYGQVQGFKVY
MYDNPDPKSFYRPYHSTVDRVMGECSVFLGIPYALPPTFEGRFKPPRVHR
GWQLLQAVDFGPACPQPVRYTGATKGIMDMDEDCLYLNVYSPKTGAGVAQ
KYPVMVYIHGGEFIRGASNLFQGHILASFYDVVVVTLNYRLGALGFLSTG
DENSPGNYGILDQAMALRWVYDNIEFFNGDRNSITLFGPGAGGASAGLLM
VAPQTRNIVRRVIAQSGSALADWALIQDKYRAQNTSRVLGQLLGCSIESS
WKLVNCLRTGRSFYELGNAEFSPQVGSFPWGPVLDHNFTLPGDDWYEGWR
EKDWRFLTKTPETLIRAGKFNRNIQYMTGVTTQEAAFFVAQNESLSPYYE
LDGRFFDQKIREHVFRYNYTLNPNGVYEAIKYMYTFWPDPNNNTIIRDQY
INMLSDLYYRAPVDQMVKLMLEQKVPVYMYVLNTTVEALNLPQWRKYPHD
IERYFLTGAPFMDTEFFPKKEHLQRNMWTDNDRNMSHFFMQTYTNFARYG
NPTPQQVLGMHFQRAYQGEIRYLNINTTYNSSILLNYRQTECAFWTQYLP
TVIGVLVPTYPPTTEYWWEPKEPLQIAFWSMSVACFFLIVLVVICCIMWR
NAKRQSDRFYDEDVFINGEGLEPEQDTRGVDNAHMVTNHHALRSRDNIYE
YRDSPSTKTLASKAHTDTTSLRSPSSLAMTQKSSSQASLKSGISLKETNG
HLVKQSERAATPRSQQNGSIAKVASPPVEEKRLLQPLSSTPVTQLQAEPA
KRVPTAASVSGSSRSTTPVPSARSTTTHTTTATLSSQPAAQPRRTHLVEG
VPQTSV

Graphical view for this nucleotide DNA sequence (4009 bp): drome-glita



References
4 more
    Title: Overexpressed Gliotactin activates BMP signaling through interfering with the Tkv-Dad association
    Sharifkhodaei Z, Auld VJ
    Ref: Genome, :1, 2020 : PubMed

            

    Title: The Drosophila tricellular junction protein Gliotactin regulates its own mRNA levels through BMP-mediated induction of miR-184
    Sharifkhodaei Z, Padash-Barmchi M, Gilbert MM, Samarasekera G, Fulga TA, Van Vactor D, Auld VJ
    Ref: Journal of Cell Science, 129:1477, 2016 : PubMed

            

    Title: Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence
    Celniker SE, Wheeler DA, Kronmiller B, Carlson JW, Halpern A, Patel S, Adams M, Champe M, Dugan SP and Rubin GM <22 more author(s)>
    Ref: Genome Biol, 3:RESEARCH0079, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer