myctu-Rv3097c

 
Mycobacterium tuberculosis, Mycobacterium bovis, Rv3097c lipY PE-PGRS family protein triglycerol acyl hydrolase esterase/lipase

Comment
(from Uniprot) Catalyzes the hydrolysis of both intracellular and extracellular triacylglycerol (TAG). In vitro, can also hydrolyze p-nitrophenyl (pNP) esters with various chain lengths, including pNP-acetate (C2), pNP-butyrate (C4), pNP-caproate (C6), pNP-caprylate (C8), pNP-laurate (C12), pNP-myristate (C14), pNP-palmitate (C16) and pNP-stearate (C18). Also hydrolyzes monobutyrin, tributyrin and trioctanoin. Overexpression results in increase of virulence characterized by reduced survival of infected mouse and increased burden of bacilli in the lungs. Hydrolyzes internal or host-derived TAG depending on its localization. Hydrolyzes TAG that accumulates within mycobacterial intracytosolic lipid inclusions (ILI). Probably responsible for the utilization of stored long-chain TAG during the dormancy and reactivation stages of the pathogen. N-terminal also homologous to PE subfamily of glycine-rich proteins. There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains.


Relationship
Block H
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic


Inhibitor: Cyclipostin-P ,
>3 Genbank links 20 more: U76006, Z95150, DS016977
3 UniProt : A5U7B2, Q7D648, I6Y2J4
1 Ncbi-nid : 1661228
2 Ncbi-pid : 1661229, 2076672
>3 UniProtTrembl links 1 more: P77909, A5U7B2, Q7D648
>3 Interpro links 1 more: P77909, A5U7B2, Q7D648
>3 Prodom links 1 more: P77909, A5U7B2, Q7D648
>3 Pfam links 1 more: P77909, A5U7B2, Q7D648
>3 PIRSF links 1 more: P77909, A5U7B2, Q7D648
>3 SUPERFAM links 1 more: P77909, A5U7B2, Q7D648
>3 QuickSwissBlast links 1 more: P77909, A5U7B2, Q7D648
 
Sequence
Graphical view for this peptide sequence: myctu-Rv3097c
Colored MSA for Hormone-sensitive_lipase_like (raw)
MVSYVVALPEVMSAAATDVASIGSVVATASQGVAGATTTVLAAAEDEVSA
AIAALFSGHGQDYQALSAQLAVFHERFVQALTGAAKGYAAAELANASLLQ
SEFASGIGNGFATIHQEIQRAPTALAAGFTQVPPFAAAQAGIFTGTPSGA
AGFDIASLWPVKPLLSLSALETHFAIPNNPLLALIASDIPPLSWFLGNSP
PPLLNSLLGQTVQYTTYDGMSVVQITPAHPTGEYVVAIHGGAFILPPSIF
HWLNYSVTAYQTGATVQVPIYPLVQEGGTAGTVVPAMAGLISTQIAQHGV
SNVSVVGDSAGGNLALAAAQYMVSQGNPVPSSMVLLSPWLDVGTWQISQA
WAGNLAVNDPLVSPLYGSLNGLPPTYVYSGSLDPLAQQAVVLEHTAVVQG
APFSFVLAPWQIHDWILLTPWGLLSWPQINQQLGIAA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVSYVVALPEVMSAAATDVASIGSVVATASQGVAGATTTVLAAAEDEVSA
AIAALFSGHGQDYQALSAQLAVFHERFVQALTGAAKGYAAAELANASLLQ
SEFASGIGNGFATIHQEIQRAPTALAAGFTQVPPFAAAQAGIFTGTPSGA
AGFDIASLWPVKPLLSLSALETHFAIPNNPLLALIASDIPPLSWFLGNSP
PPLLNSLLGQTVQYTTYDGMSVVQITPAHPTGEYVVAIHGGAFILPPSIF
HWLNYSVTAYQTGATVQVPIYPLVQEGGTAGTVVPAMAGLISTQIAQHGV
SNVSVVGDSAGGNLALAAAQYMVSQGNPVPSSMVLLSPWLDVGTWQISQA
WAGNLAVNDPLVSPLYGSLNGLPPTYVYSGSLDPLAQQAVVLEHTAVVQG
APFSFVLAPWQIHDWILLTPWGLLSWPQINQQLGIAA

Graphical view for this nucleotide DNA sequence (1357 bp): myctu-Rv3097c



References
8 more
    Title: Increased virulence of Mycobacterium tuberculosis H37Rv overexpressing LipY in a murine model
    Singh VK, Srivastava M, Dasgupta A, Singh MP, Srivastava R, Srivastava BS
    Ref: Tuberculosis (Edinb), 94:252, 2014 : PubMed

            

    Title: Whole genome sequence analysis of Mycobacterium bovis bacillus Calmette-Guerin (BCG) Tokyo 172: a comparative study of BCG vaccine substrains
    Seki M, Honda I, Fujita I, Yano I, Yamamoto S, Koyama A
    Ref: Vaccine, 27:1710, 2009 : PubMed

            

    Title: Genome plasticity of BCG and impact on vaccine efficacy
    Brosch R, Gordon SV, Garnier T, Eiglmeier K, Frigui W, Valenti P, Dos Santos S, Duthoy S, Lacroix C and Cole ST <10 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 104:5596, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer