myctu-rv0183

 
Mycobacterium tuberculosis, Mycobacterium bovis gene lipG Rv0183/mtbMGL

Comment
Inhibiting Monoacylglycerol lipases (MGLs) degrading lipases might have toxic effects onto M. tuberculosis. It is a potential drug target that remains accessible during the dormant phase of Mtb infection (see Aschauer et al.). JZL184 a human monoacylglycerol lipase selective inhibitor, does not inhibits Rv0183. There are more than 3000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Block X
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
3 structures: 7OZM, 7P0Y, 6EIC
No kinetic

Substrate: Monoolein ,
Inhibitor: alkyne-PEG-FP , Maglipan , Lalistat-1 , Lalistat-2 , Cyclipostin-P ,
>3 Genbank links 33 more: Z97050, CH482374, CP000611
>3 UniProt links 5 more: Q7DAB5, A2VNA8, A5TYQ8
1 Ncbi-nid : 3256008
1 Ncbi-pid : 2213520
3 Structure : 7OZM, 7P0Y, 6EIC
3 UniProtTrembl : O07427, Q7DAB5, A5TYQ8
3 Interpro : O07427, Q7DAB5, A5TYQ8
3 Prodom : O07427, Q7DAB5, A5TYQ8
3 Pfam : O07427, Q7DAB5, A5TYQ8
3 PIRSF : O07427, Q7DAB5, A5TYQ8
3 SUPERFAM : O07427, Q7DAB5, A5TYQ8
3 QuickSwissBlast : O07427, Q7DAB5, A5TYQ8
 
Sequence
Graphical view for this peptide sequence: myctu-rv0183
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MWAEKSPRRSSAGSRPEFSASTLTSMSLRRVSDTLTGAAVTLPVMTTTRT
ERNFAGIGDVRIVYDVWTPDTAPQAVVVLAHGLGEHARRYDHVAQRLGAA
GLVTYALDHRGHGRSGGKRVLVRDISEYTADFDTLVGIATREYPGCKRIV
LGHSMGGGIVFAYGVERPDNYDLMVLSAPAVAAQDLVSPVVAVAAKLLGV
VVPGLPVQELDFTAISRDPEVVQAYNTDPLVHHGRVPAGIGRALLQVGET
MPRRAPALTAPLLVLHGTDDRLIPIEGSRRLVECVGSADVQLKEYPGLYH
EVFNEPERNQVLDDVVAWLTERL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWAEKSPRRSSAGSRPEFSASTLTSMSLRRVSDTLTGAAVTLPVMTTTRT
ERNFAGIGDVRIVYDVWTPDTAPQAVVVLAHGLGEHARRYDHVAQRLGAA
GLVTYALDHRGHGRSGGKRVLVRDISEYTADFDTLVGIATREYPGCKRIV
LGHSMGGGIVFAYGVERPDNYDLMVLSAPAVAAQDLVSPVVAVAAKLLGV
VVPGLPVQELDFTAISRDPEVVQAYNTDPLVHHGRVPAGIGRALLQVGET
MPRRAPALTAPLLVLHGTDDRLIPIEGSRRLVECVGSADVQLKEYPGLYH
EVFNEPERNQVLDDVVAWLTERL

Graphical view for this nucleotide DNA sequence (1006 bp): myctu-rv0183



References
10 more
    Title: Structural Changes in the Cap of Rv0183/mtbMGL Modulate the Shape of the Binding Pocket
    Grininger C, Leypold M, Aschauer P, Pavkov-Keller T, Riegler-Berket L, Breinbauer R, Oberer M
    Ref: Biomolecules, 11:1299, 2021 : PubMed

            

    Title: Anti-tubercular derivatives of rhein require activation by the monoglyceride lipase Rv0183
    Abrahams KA, Hu W, Li G, Lu Y, Richardson EJ, Loman NJ, Huang H, Besra GS
    Ref: Cell Surf, 6:100040, 2020 : PubMed

            

    Title: The crystal structure of monoacylglycerol lipase from M. tuberculosis reveals the basis for specific inhibition
    Aschauer P, Zimmermann R, Breinbauer R, Pavkov-Keller T, Oberer M
    Ref: Sci Rep, 8:8948, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer