Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacce-BC4862

Bacillus cereus, Bacillus anthracis, Bacillus thuringiensis, Bacillus weihenstephanensis,Bacillus mycoides, lipase (EC 3.1.1.3)

Comment
Other strains: Bacillus cereus (ATCC 14579 / DSM 31; ZK; ATCC 10987; G9241; NVH0597-99; R309803; BGSC 6E1; B4264; 03BB102; ATCC 14579 / DSM 31; Rock3-42; W; AH1273; Q1; G9842; ATCC 4342; H3081.97; 95/8201; Rock1-3; 03BB108; AH187; var. anthracis CI; Rock3-28; Rock3-29; BDRD-ST196; m1550; BDRD-Cer4; AH1134; AH1272; MM3; AH676; Rock1-15; BDRD-ST24; AH820; AH603; F65185; BDRD-ST26; AH1271; 172560W; m1293; Rock4-2; ATCC 10876; AH621), Bacillus thuringiensis (subsp. konkukian; Al Hakam; BMB171; subsp. finitimus (strain YBT-020); IBL 200; IBL 4222; Bt407; serovars: israelensis ATCC 35646, pakistani str. T13001, pondicheriensis BGSC 4BA1, monterrey BGSC 4AJ1, tochigiensis BGSC 4Y1, sotto str. T04001, berliner ATCC 10792, thuringiensis str. T01001, huazhongensis BGSC 4BD1, kurstaki str. T03a001, chinensis CT-43, pulsiensis BGSC 4CC1, andalousiensis BGSC 4AW1), Bacillus anthracis (Ames; A0488; A0248; A0442; Tsiankovskii-I; A0193; A0465; A0174; CDC 684 / NRRL 3495; A0389), Bacillus weihenstephanensis (strain KBAB4), Bacillus mycoides DSM 2048, uncultured soil bacterium


Relationship
Family|Lipase_3
Block| L
Position in NCBI Life Tree|Bacillus cereus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus cereus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 5 more: CP000001, AE017280, AE017013
>3 UniProt links 35 more: Q816H0, Q72YJ9, Q632H6
>3 UniProt links 35 more: Q816H0, Q72YJ9, Q632H6
>3 Interpro links 35 more: Q816H0, Q72YJ9, Q632H6
>3 Prodom links 35 more: Q816H0, Q72YJ9, Q632H6
>3 Pfam links 35 more: Q816H0, Q72YJ9, Q632H6
>3 PIRSF links 35 more: Q816H0, Q72YJ9, Q632H6
>3 SUPERFAM links 35 more: Q816H0, Q72YJ9, Q632H6
Sequence
Graphical view for this peptide sequence: bacce-BC4862
Colored MSA for Lipase_3 (raw)
MRTPLSFDKDTAILLASCCELTYEQYKQNGIFEIPDGFQYVQGFQGKAIQ
TTEWFGFILESEDTIIVAFRGTQTDPDWIIDSLVNQKPYPYALNGGNVHN
GFLSIYESCRDSIMDMLVSLPAHKKLLATGHSLGGALATLHILDARINTA
FAQYGLYTFASPKVGDIAFRNYYKLQVASSFRFVNLFDVVPLLPPRNINF
NDHDWEYAHVHHNMTFTKNTKSITNNHSITTYKTCLTSHF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRTPLSFDKDTAILLASCCELTYEQYKQNGIFEIPDGFQYVQGFQGKAIQ
TTEWFGFILESEDTIIVAFRGTQTDPDWIIDSLVNQKPYPYALNGGNVHN
GFLSIYESCRDSIMDMLVSLPAHKKLLATGHSLGGALATLHILDARINTA
FAQYGLYTFASPKVGDIAFRNYYKLQVASSFRFVNLFDVVPLLPPRNINF
NDHDWEYAHVHHNMTFTKNTKSITNNHSITTYKTCLTSHF


References
10 more
    Title: Structural and functional insights about unique extremophilic bacterial lipolytic enzyme from metagenome source
    Kaur R, Kumar R, Verma S, Kumar A, Rajesh C, Sharma PK
    Ref: Int J Biol Macromol, :, 2020 : PubMed

            

    Title: The genome sequence of Bacillus cereus ATCC 10987 reveals metabolic adaptations and a large plasmid related to Bacillus anthracis pXO1
    Rasko DA, Ravel J, Okstad OA, Helgason E, Cer RZ, Jiang L, Shores KA, Fouts DE, Tourasse NJ and Read TD <5 more author(s)>
    Ref: Nucleic Acids Research, 32:977, 2004 : PubMed

            

    Title: Genome sequence of Bacillus cereus and comparative analysis with Bacillus anthracis.
    Ivanova N, Sorokin A, Anderson I, Galleron N, Candelon B, Kapatral V, Bhattacharyya A, Reznik G, Mikhailova N and Kyrpides N <13 more author(s)>
    Ref: Nature, 423:87, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer