drome-nlg3

 
Drosophila melanogaster (Fruit fly) CG14597 gene

Comment
Nucleotide sequence from Celera. Sequence homologous to neuroligins, with a long stretch of Ser. WARNING not an enzyme belongs to a cluster of sequences upstream of alpha-esterase cluster


Relationship
Family Neuroligin
Block C
Drosophila melanogaster position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > melanogaster group: N E > melanogaster subgroup: N E > Drosophila melanogaster: N E

Molecular evidence
Database
1 mutation: drome-nlg3
No structure
No kinetic



>3 Genbank links 2 more: AE003671, NP_001036685, NP_731170
1 Ncbi-pid : 7298790
1 UniProtTrembl : Q9VIC6
1 Interpro : Q9VIC6
1 Prodom : Q9VIC6
1 Pfam : Q9VIC6
1 PIRSF : Q9VIC6
1 SUPERFAM : Q9VIC6
1 QuickSwissBlast : Q9VIC6
1 FlyBase : 0037509
 
Sequence
Graphical view for this peptide sequence: drome-nlg3
Colored MSA for Neuroligin (raw)
MVMLLSKRQLPPSAATRTRRKVPPTRRRSTWALSSLLALVVLDICIARCL
AAGISYSSNSGNLSTSQKSPSSANNGGLVLIGSSSATSSSVPSLSLTSSS
SAGLSSPGSSSSSSSSSTSTSGSNSNRSSRPTSNNSNSNSNYSPNHDQLP
AQLSSRIINTRNGAISGVIVQLDGRHLDPVEAYRGIPYASPPVGNLRFMP
PVSAAMWSGVKKADRFSPVCPQRLPDIHNETAALERMPKGRLEYLKRLLP
YLQNQSEDCLYLNIYVPIQVGSRDSSGSSSSSSAGSSSSGSGGSSSSSSS
SSTSSSSAGSGSPAKYPVLVFVHGESYEWNSGNPYDGSVLASYGQILVVT
INYRLGVLGFLNANTDRYSKLPANYGLMDIIAALHWLKENIAAFGGDPNS
ITLAGHGTGAACVHFLISSMAVPEGLLFNRAILMSGSGLAPWSLVSNPAK
YAAIVAHHVNCASDLPHAHLMKCLREKTLDQLLSVPIRPPEFGFAFGPSI
DGVVIDGGDYVPPAPGSPAAQAQAQASTAAGNGLGGEAGIAAAGGWGTPG
QLENIVLMRKTAINKLSRYDLMAGVTRAEAFFSFNSGDVQYGIEADRRSR
ILKAYVRNTYTFHLNEIFATIVNEYTDWERPVQHPINIRDETLEALSDAQ
VVAPAAQTVDLHSADHRNSYLYVFDYQTRFGDYPQRQGCIHGEDLPYIFG
APLVGGFNHFTRNYTKTEISLSEVVMFYWSNFVRTGNPNEQMETEHGSRQ
ERSRYKTIEWTAYESVHKKYLNFDTKPKLKNHYRAHRLSFWLNLIPDLHK
PGGDNVPAAHHQLHDDDDEDNNIPSDASVKPLNPPYISRAANAAAMANFT
IFTNQVFSLLNLSSPSSSLQRNGTRYGGGKIYPDDMMDGDHAGGAASASQ
DSDGFAAYSTALSVTIAIGCSLLILNVLIFAGVYYQRDKTRLSEPRPQTK
LKRQENGQMPNNICGDLETLTIHAKSDPATILSHHHAMQHHQLPPPEFAD
IPHRAPPPPKHMKSLQDPGGGGSVSGAVGVSGVVQMPPPHALQVMGNQCG
TLTKKSCMKQTQAQAQQHSPAQQQQQQQQQQQQHVVTHQQHLQNHHNQSM
TTVLTTAGGLVVPTPPTVPVIVASTTQHQQHQQQHQQQQHQQQQQQQQQQ
HPLMDELRV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVMLLSKRQLPPSAATRTRRKVPPTRRRSTWALSSLLALVVLDICIARCL
AAGISYSSNSGNLSTSQKSPSSANNGGLVLIGSSSATSSSVPSLSLTSSS
SAGLSSPGSSSSSSSSSTSTSGSNSNRSSRPTSNNSNSNSNYSPNHDQLP
AQLSSRIINTRNGAISGVIVQLDGRHLDPVEAYRGIPYASPPVGNLRFMP
PVSAAMWSGVKKADRFSPVCPQRLPDIHNETAALERMPKGRLEYLKRLLP
YLQNQSEDCLYLNIYVPIQVGSRDSSGSSSSSSAGSSSSGSGGSSSSSSS
SSTSSSSAGSGSPAKYPVLVFVHGESYEWNSGNPYDGSVLASYGQILVVT
INYRLGVLGFLNANTDRYSKLPANYGLMDIIAALHWLKENIAAFGGDPNS
ITLAGHGTGAACVHFLISSMAVPEGLLFNRAILMSGSGLAPWSLVSNPAK
YAAIVAHHVNCASDLPHAHLMKCLREKTLDQLLSVPIRPPEFGFAFGPSI
DGVVIDGGDYVPPAPGSPAAQAQAQASTAAGNGLGGEAGIAAAGGWGTPG
QLENIVLMRKTAINKLSRYDLMAGVTRAEAFFSFNSGDVQYGIEADRRSR
ILKAYVRNTYTFHLNEIFATIVNEYTDWERPVQHPINIRDETLEALSDAQ
VVAPAAQTVDLHSADHRNSYLYVFDYQTRFGDYPQRQGCIHGEDLPYIFG
APLVGGFNHFTRNYTKTEISLSEVVMFYWSNFVRTGNPNEQMETEHGSRQ
ERSRYKTIEWTAYESVHKKYLNFDTKPKLKNHYRAHRLSFWLNLIPDLHK
PGGDNVPAAHHQLHDDDDEDNNIPSDASVKPLNPPYISRAANAAAMANFT
IFTNQVFSLLNLSSPSSSLQRNGTRYGGGKIYPDDMMDGDHAGGAASASQ
DSDGFAAYSTALSVTIAIGCSLLILNVLIFAGVYYQRDKTRLSEPRPQTK
LKRQENGQMPNNICGDLETLTIHAKSDPATILSHHHAMQHHQLPPPEFAD
IPHRAPPPPKHMKSLQDPGGGGSVSGAVGVSGVVQMPPPHALQVMGNQCG
TLTKKSCMKQTQAQAQQHSPAQQQQQQQQQQQQHVVTHQQHLQNHHNQSM
TTVLTTAGGLVVPTPPTVPVIVASTTQHQQHQQQHQQQQHQQQQQQQQQQ
HPLMDELRV

no DNA




References
    Title: Abnormal Social Interactions in a Drosophila Mutant of an Autism Candidate Gene: Neuroligin 3
    Yost RT, Robinson JW, Baxter CM, Scott AM, Brown LP, Aletta MS, Hakimjavadi R, Lone A, Cumming RC and Simon AF <2 more author(s)>
    Ref: Int J Mol Sci, 21:, 2020 : PubMed

            

    Title: Drosophila neuroligin3 regulates neuromuscular junction development and synaptic differentiation
    Xing G, Gan G, Chen D, Sun M, Yi J, Lv H, Han J, Xie W
    Ref: Journal of Biological Chemistry, 289:31867, 2014 : PubMed

            

    Title: The genome sequence of Drosophila melanogaster
    Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA and Venter JC <185 more author(s)>
    Ref: Science, 287:2185, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer