human-ABHD17A

 
Homo sapiens (Human) Abhydrolase domain-containing protein FAM108A1, C19orf27 ABHD17A

Comment
ABHD17 proteins are protein depalmitoylases that regulate N-Ras palmitate turnover and subcellular localization (Lin and Conibear 2015) They are probably themselves palmitoylated. ABHD17A, 17B, and 17C,are identified as the physiological PSD-95 (the most abundant postsynaptic density scaffolding protein) depalmitoylating enzymes in neurones (Yokoi et al.)


Relationship
Block X
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
No mutation
No structure
No kinetic

Substrate: Depalmitoylation-probe-2 ,
Inhibitor: Palmostatin-B ,
>3 Genbank links 4 more: BC009256, BC020512, BC000158
1 UniProt : Q96GS6
1 UniProtTrembl : Q96GS6
1 Interpro : Q96GS6
1 Prodom : Q96GS6
1 Pfam : Q96GS6
1 PIRSF : Q96GS6
1 SUPERFAM : Q96GS6
1 QuickSwissBlast : Q96GS6
1 EntrezGene : 81926
1 SNP : 81926
1 UniGene : 653679
1 HUGO HGNC : 28756
1 Ensembl : ENSG00000129968
 
Sequence
Graphical view for this peptide sequence: human-ABHD17A
Colored MSA for ABHD17-depalmitoylase (raw)
MNGLSLSELCCLFCCPPCPGRIAAKLAFLPPEATYSLVPEPEPGPGGAGA
APLGTLRASSGAPGRWKLHLTERADFQYSQRELDTIEVFPTKSARGNRVS
CMYVRCVPGARYTVLFSHGNAVDLGQMSSFYIGLGSRLHCNIFSYDYSGY
GASSGRPSERNLYADIDAAWQALRTRYGISPDSIILYGQSIGTVPTVDLA
SRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKVSKITSPVLII
HGTEDEVIDFSHGLALYERCPKAVEPLWVEGAGHNDIELYSQYLERLRRF
ISQELPSQRA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNGLSLSELCCLFCCPPCPGRIAAKLAFLPPEATYSLVPEPEPGPGGAGA
APLGTLRASSGAPGRWKLHLTERADFQYSQRELDTIEVFPTKSARGNRVS
CMYVRCVPGARYTVLFSHGNAVDLGQMSSFYIGLGSRLHCNIFSYDYSGY
GASSGRPSERNLYADIDAAWQALRTRYGISPDSIILYGQSIGTVPTVDLA
SRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKVSKITSPVLII
HGTEDEVIDFSHGLALYERCPKAVEPLWVEGAGHNDIELYSQYLERLRRF
ISQELPSQRA

no DNA




References
4 more
    Title: Site specific deacylation by ABHD17a controls BK channel splice variant activity
    McClafferty H, Runciman H, Shipston MJ
    Ref: Journal of Biological Chemistry, 295:16487, 2020 : PubMed

            

    Title: Dynamic Palmitoylation Targets MAP6 to the Axon to Promote Microtubule Stabilization during Neuronal Polarization
    Tortosa E, Adolfs Y, Fukata M, Pasterkamp RJ, Kapitein LC, Hoogenraad CC
    Ref: Neuron, 94:809, 2017 : PubMed

            

    Title: Identification of PSD-95 Depalmitoylating Enzymes
    Yokoi N, Fukata Y, Sekiya A, Murakami T, Kobayashi K, Fukata M
    Ref: Journal of Neuroscience, 36:6431, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer