Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: drome-nrtac

Drosophila melanogaster (Fruit fly) mRNA for neurotactin

Comment
Adhesion protein Nucleotide sequence of the Celera sequence differs from the published sequence for this transcript


Relationship
Family|Neurotactin
Block| C
Position in NCBI Life Tree|Drosophila melanogaster
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > melanogaster group: N E > melanogaster subgroup: N E > Drosophila melanogaster: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: X54999, AF132188, AE003526
2 UniProt : P23654, M9MS15
2 Ncbi-nid : 8289, 4972761
2 Ncbi-pid : 4972762, 7294062
2 UniProt : P23654, M9MS15
2 Interpro : P23654, M9MS15
2 Prodom : P23654, M9MS15
2 Pfam : P23654, M9MS15
2 PIRSF : P23654, M9MS15
2 SUPERFAM : P23654, M9MS15
1 FlyBase : 0004108
Sequence
Graphical view for this peptide sequence: drome-nrtac
Colored MSA for Neurotactin (raw)
MGELEEKETPPTETTAAQQEALEEPKETDKMLDKKEDAKEKTPSPQTSKP
ASPNAGKKSSPVAEKKIDDAELAKSKSGNGEEIIDIPAENGTKPDSADDK
KISKEEREVKPKKIPIGGLKLPGFFMKNKPKADGDGAEGELLEKEKEEDK
DKEANGDAATGSGKDEQKSRPGLGERLRSFFARKPSAEKEKKQLVNGDAD
AKSEATAEATPAEDASDAPPKRGLLNAIKLPIANMIPKKKSNDDVELGLG
KAGLASMETLDDSLKDQDTVDRAPVKTNGTEELKGELKDEKLAAEEKLAA
EEEEQNRPVSLLTRLRGYKCSVDDALIVFGILLFVLLLGVIGYVLTHETL
TSPPLREGRYIMAVTGCGPVEGVKEDGAFAFRGIPYAKPPVDRLRWKPAE
LIDDINMCWNDTLQTHNSSVVCTQRLGNGTTVGDEDCLYLDVVTPHVRYN
NPLPVVVLIGAESLAGPSPGILRPSARYSRSHDVIFVRPNFRLGVFGFLA
LDALTKEAHPPTSGNYALTDIIAVLNWIKLNIVHFGGDPQSVTLLGHRAG
ATLVSLLVNSQKVKGLFTRAWASSGSAILPGKPLSESGKQNEQLMATLEC
ADIQCLREASSERLWAATPDTWLHFPVDLPQPQEANASGSRHEWLVLDGD
VVFEHPSDTWKREQANDKPVLVMGATAHEAHTEKLRELHANWTREEVRAY
LENSQIGALGLTDEVIEKYNASSYASLVSIISDIRSVCPLLTNARQQPSV
PFYVVTQGEGPDQLATVDADVQAILGRYEPHTVEQRRFVSAMQQLFYYYV
SHGTVQSFVQNRRVINVGQDAQPEEDYLPCNYWISKDIVPRYARVD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGELEEKETPPTETTAAQQEALEEPKETDKMLDKKEDAKEKTPSPQTSKP
ASPNAGKKSSPVAEKKIDDAELAKSKSGNGEEIIDIPAENGTKPDSADDK
KISKEEREVKPKKIPIGGLKLPGFFMKNKPKADGDGAEGELLEKEKEEDK
DKEANGDAATGSGKDEQKSRPGLGERLRSFFARKPSAEKEKKQLVNGDAD
AKSEATAEATPAEDASDAPPKRGLLNAIKLPIANMIPKKKSNDDVELGLG
KAGLASMETLDDSLKDQDTVDRAPVKTNGTEELKGELKDEKLAAEEKLAA
EEEEQNRPVSLLTRLRGYKCSVDDALIVFGILLFVLLLGVIGYVLTHETL
TSPPLREGRYIMAVTGCGPVEGVKEDGAFAFRGIPYAKPPVDRLRWKPAE
LIDDINMCWNDTLQTHNSSVVCTQRLGNGTTVGDEDCLYLDVVTPHVRYN
NPLPVVVLIGAESLAGPSPGILRPSARYSRSHDVIFVRPNFRLGVFGFLA
LDALTKEAHPPTSGNYALTDIIAVLNWIKLNIVHFGGDPQSVTLLGHRAG
ATLVSLLVNSQKVKGLFTRAWASSGSAILPGKPLSESGKQNEQLMATLEC
ADIQCLREASSERLWAATPDTWLHFPVDLPQPQEANASGSRHEWLVLDGD
VVFEHPSDTWKREQANDKPVLVMGATAHEAHTEKLRELHANWTREEVRAY
LENSQIGALGLTDEVIEKYNASSYASLVSIISDIRSVCPLLTNARQQPSV
PFYVVTQGEGPDQLATVDADVQAILGRYEPHTVEQRRFVSAMQQLFYYYV
SHGTVQSFVQNRRVINVGQDAQPEEDYLPCNYWISKDIVPRYARVD


References
9 more
    Title: Drosophila neurotactin mediates heterophilic cell adhesion
    Barthalay Y, Hipeau-Jacquotte R, de la Escalera S, Jimenez F, Piovant M
    Ref: EMBO Journal, 9:3603, 1990 : PubMed

            

    Title: Drosophila neurotactin, a surface glycoprotein with homology to serine esterases, is dynamically expressed during embryogenesis
    Hortsch M, Patel NH, Bieber AJ, Traquina ZR, Goodman CS
    Ref: Development, 110 (4):1327, 1990 : PubMed

            

    Title: Characterization and gene cloning of neurotactin, a Drosophila transmembrane protein related to cholinesterases
    de la Escalera S, Bockamp EO, Moya F, Piovant M, Jimenez F
    Ref: EMBO Journal, 9:3593, 1990 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer