drome-este6

 
Drosophila melanogaster (Fruit fly) gene for carboxylesterase 6 and P the odorant degrading enzyme

Comment
Nucleotide sequence of the Celera sequence differs from the published sequence for this transcript numerous other strain see the tree display KEIVLLN GLS replaces TVHGDDYFLIFENFVRDVEMRPDEQIISRNFINMLADFASSDNGSLKYGECDFKDNVGSEKFQLLAIYIDGCQNRQHVEFP at the C-term of Q8SWT4 Stappleton et al. (genbank numbers for numerous strains: AE003542, AAB46703, U57485, AF147095, AF147096, AF147097, AF147098, AF147099, AF147100, AF147101, AF147102, AF217624, AF217625, AF217626, AF217627, AF217628, AF217629, AF217630, AF217631, AF217632, AF217633, AF217634, AF217635, AF217636, AF217637, AF217638, AF217639, AF217640, AF217641, AF217642, AF217643, AF217644, U57474, U57475, U57476, U57477, U57478, U57479, U57480, U57481, U57482, U57483, U57484, U57486, U57487, U57488, DQ500558, DQ500562, DQ500563, DQ500638, DQ500639, DQ500445, DQ500446, DQ500447, DQ500448, DQ500450, DQ500456, DQ500458, DQ500461, DQ500462, DQ500464, DQ500465, DQ500468, DQ500469, DQ500492, DQ500498, DQ500502, DQ500509, DQ500518, DQ500525, DQ500527, DQ500531, DQ500535, DQ500540, DQ500542, DQ500553, DQ500612, DQ500613, DQ500621, DQ500623, DQ500626, DQ500631, DQ500645, DQ500656, DQ500657, DQ500658, DQ500663, DQ500664, DQ500668, DQ500669, DQ500672, DQ500673, DQ500674, DQ500675, DQ500676, DQ500681, DQ500686, DQ500690, DQ500691, DQ500692, DQ500696, DQ500707, DQ500711, DQ500712, DQ500731, DQ500733, DQ500738, DQ500475, DQ500480, DQ500496, DQ500503, DQ500504, DQ500505, DQ500507, DQ500517, DQ500520, DQ500522, DQ500524, DQ500526, DQ500566, DQ500567, DQ500569, DQ500570, DQ500572, DQ500575, DQ500580, DQ500581, DQ500582, DQ500583, DQ500586, DQ500587, DQ500590, DQ500595, DQ500596, DQ500597, DQ500599, DQ500605, DQ500607, DQ500608, DQ500619, DQ500641, DQ500647, DQ500649, DQ500652, DQ500655DQ500555, DQ500478, DQ500479, DQ500482, DQ500510, DQ500523, DQ500529, DQ500568, DQ500571, DQ500574, DQ500601, DQ500604, DQ500609, DQ500642, DQ500643, DQ500654, DQ500449, DQ500452, DQ500485, DQ500487, DQ500508, DQ500533, DQ500539, DQ500543, DQ500549, DQ500550, DQ500552, DQ500592, DQ500610, DQ500662, DQ500697, DQ500714, DQ500726, DQ500727, DQ500729, DQ500470, DQ500471, DQ500472, DQ500494, DQ500495, DQ500559, DQ500560, DQ500561, DQ500637, DQ500640, DQ500709, DQ500710, DQ500444, DQ500451, DQ500455, DQ500457, DQ500459, DQ500460, DQ500463, DQ500466, DQ500467, DQ500486, DQ500488, DQ500489, DQ500491, DQ500493, DQ500499, DQ500501, DQ500506, DQ500519, DQ500530, DQ500532, DQ500536, DQ500537, DQ500538, DQ500541, DQ500544, DQ500545, DQ500546, DQ500547, DQ500548, DQ500551, DQ500554, DQ500556, DQ500557, DQ500584, DQ500616, DQ500624, DQ500625, DQ500628, DQ500629, DQ500630, DQ500632, DQ500633, DQ500634, DQ500635, DQ500636, DQ500653, DQ500659, DQ500660, DQ500661, DQ500665, DQ500666, DQ500667, DQ500671, DQ500677, DQ500678, DQ500680, DQ500683, DQ500684, DQ500687, DQ500688, DQ500689, DQ500693, DQ500695, DQ500698, DQ500699, DQ500700, DQ500701, DQ500702, DQ500703, DQ500704, DQ500705, DQ500706, DQ500708, DQ500713, DQ500715, DQ500716, DQ500717, DQ500718, DQ500719, DQ500720, DQ500721, DQ500722, DQ500723, DQ500724, DQ500725, DQ500728, DQ500730, DQ500732, DQ500734, DQ500735, DQ500736, DQ500737, DQ500739, DQ500740, DQ500741, DQ500473, DQ500474, DQ500476, DQ500477, DQ500481, DQ500483, DQ500500, DQ500511, DQ500512, DQ500513, DQ500514, DQ500515, DQ500516, DQ500521, DQ500528, DQ500565, DQ500573, DQ500576, DQ500577, DQ500578, DQ500585, DQ500588, DQ500589, DQ500591, DQ500593, DQ500594, DQ500598, DQ500602, DQ500606, DQ500611, DQ500615, DQ500617, DQ500618, DQ500620, DQ500622, DQ500627, DQ500644, DQ500648, DQ500650, DQ500651, DQ500453, DQ500454, DQ500490, DQ500534, DQ500670, DQ500679, DQ500682, DQ500685, DQ500694, DQ500484, DQ500497, DQ500564, DQ500579, DQ500600, DQ500603, DQ500614, DQ500646, AY095091, AY247673, AY247674, AY247675, AY247676, AY247677, AY247713, AY247667, AY247669, AY247664, AY247671, AY247683, AY247684, AY247685, AY247686, AY247687, AY247712, AY247711, AY247710, AY247709, AY247708, AY247707, AY247706, AY247705, AY247704, AY247702, AY247700, AY247682, AY247666, AY247665


Relationship
Block C
Drosophila melanogaster position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > melanogaster group: N E > melanogaster subgroup: N E > Drosophila melanogaster: N E

Molecular evidence
Database
No mutation
1 structure:
5THM: The odorant degrading enzyme Esterase-6 from Drosophila Melanogaster
No kinetic


Inhibitor: NBD-HE-HP ,
>3 Genbank links 5 more: AAA28519, M33780, J04167
3 UniProt : P08171, C9QP21, A0A0U3SHB6
2 Ncbi-nid : 1832163, 157377
2 Ncbi-pid : 7294607, 1832164
1 Structure : 5THM
>3 UniProtTrembl links 12 more: P08171, Q15DR8, Q15DG9
>3 Interpro links 12 more: P08171, Q15DR8, Q15DG9
>3 Prodom links 12 more: P08171, Q15DR8, Q15DG9
>3 Pfam links 12 more: P08171, Q15DR8, Q15DG9
>3 PIRSF links 12 more: P08171, Q15DR8, Q15DG9
>3 SUPERFAM links 12 more: P08171, Q15DR8, Q15DG9
>3 QuickSwissBlast links 12 more: P08171, Q15DR8, Q15DG9
1 FlyBase : 0000592
 
Sequence
Graphical view for this peptide sequence: drome-este6
Colored MSA for Carb_B_Arthropoda (raw)
MNYVGLGLIIVLSCLWLGSNASDTDDPLLVQLPQGKLRGRDNGSYYSYES
IPYAEPPTGDLRFEAPEPYKQKWSDIFDATKTPVACLQWDQFTPGANKLV
GEEDCLTVSVYKPKNSKRNSFPVVAHIHGGAFMFGAAWQNGHENVMREGK
FILVKISYRLGPLGFVSTGDRDLPGNYGLKDQRLALKWIKQNIASFGGEP
QNVLLVGHSAGGASVHLQMLREDFGQLARAAFSFSGNALDPWVIQKGARG
RAFELGRNVGCESAEDSTSLKKCLKSKPASELVTAVRKFLIFSYVPFAPF
SPVLEPSDAPDAIITQDPRDVIKSGKFGQVPWAVSYVTEDGGYNAALLLK
ERKSGIVIDDLNERWLELAPYLLFYRDTKTKKDMDDYSRKIKQEYIGNQR
FDIESYSELQRLFTDILFKNSTQESLDLHRKYGKSPAYAYVYDNPAEKGI
AQVLANRTDYDFGTVHGDDYFLIFENFVRDVEMRPDEQIISRNFINMLAD
FASSDNGSLKYGECDFKDNVGSEKFQLLAIYIDGCQNRQHVEFP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNYVGLGLIIVLSCLWLGSNASDTDDPLLVQLPQGKLRGRDNGSYYSYES
IPYAEPPTGDLRFEAPEPYKQKWSDIFDATKTPVACLQWDQFTPGANKLV
GEEDCLTVSVYKPKNSKRNSFPVVAHIHGGAFMFGAAWQNGHENVMREGK
FILVKISYRLGPLGFVSTGDRDLPGNYGLKDQRLALKWIKQNIASFGGEP
QNVLLVGHSAGGASVHLQMLREDFGQLARAAFSFSGNALDPWVIQKGARG
RAFELGRNVGCESAEDSTSLKKCLKSKPASELVTAVRKFLIFSYVPFAPF
SPVLEPSDAPDAIITQDPRDVIKSGKFGQVPWAVSYVTEDGGYNAALLLK
ERKSGIVIDDLNERWLELAPYLLFYRDTKTKKDMDDYSRKIKQEYIGNQR
FDIESYSELQRLFTDILFKNSTQESLDLHRKYGKSPAYAYVYDNPAEKGI
AQVLANRTDYDFGTVHGDDYFLIFENFVRDVEMRPDEQIISRNFINMLAD
FASSDNGSLKYGECDFKDNVGSEKFQLLAIYIDGCQNRQHVEFP

Graphical view for this nucleotide DNA sequence (1733 bp): drome-este6



References
8 more
    Title: Molecular basis for the behavioral effects of the odorant degrading enzyme Esterase 6 in Drosophila
    Younus F, Fraser NJ, Coppin CW, Liu JW, Correy GJ, Chertemps T, Pandey G, Maibeche M, Jackson CJ, Oakeshott JG
    Ref: Sci Rep, 7:46188, 2017 : PubMed

            

    Title: An antennal carboxylesterase from , esterase 6, is a candidate odorant-degrading enzyme toward food odorants
    Chertemps T, Younus F, Steiner C, Durand N, Coppin CW, Pandey G, Oakeshott JG, Maibeche M
    Ref: Front Physiol, 6:315, 2015 : PubMed

            

    Title: Functional fat body proteomics and gene targeting reveal in vivo functions of Drosophila melanogaster a-Esterase-7
    Birner-Gruenberger R, Bickmeyer I, Lange J, Hehlert P, Hermetter A, Kollroser M, Rechberger GN, Kuhnlein RP
    Ref: Insect Biochemistry & Molecular Biology, 42:220, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer