human-PAFAH2

 
Homo sapiens (Human) (EC 3.1.1.47) platelet-activating factor acetylhydrolase 2, cytoplasmic (serine dependent phospholipase a2) (hsd-pla2), PAFAH2, PAFA2 PAF-AH

Comment
multifunctional enzyme with three catalytic activities; PAF:lysophospholipid transacetylase; PAF:sphingosine transacetylase; ;Platelet-activating factor acetyltransferase PAFAH2. EC:2.3.1.149 Serine-dependent phospholipase A2 SD-PLA2 hSD-PLA2. Oxidized-phospholipid-selective phospholipase A2


Relationship
Block X
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
No mutation
No structure
No kinetic


Inhibitor: AA39-2 , ML225 ,
>3 Genbank links 3 more: AL592064, D87845, U89386
>3 UniProt links 1 more: Q99487, Q5SY01, Q5SY00
>3 UniProtTrembl links 1 more: Q5SY01, Q5SY00, Q99487
>3 Interpro links 1 more: Q5SY01, Q5SY00, Q99487
>3 Prodom links 1 more: Q5SY01, Q5SY00, Q99487
>3 Pfam links 1 more: Q5SY01, Q5SY00, Q99487
>3 PIRSF links 1 more: Q5SY01, Q5SY00, Q99487
>3 SUPERFAM links 1 more: Q5SY01, Q5SY00, Q99487
>3 QuickSwissBlast links 1 more: Q5SY01, Q5SY00, Q99487
1 EntrezGene : 5051
1 SNP : 5051
1 UniGene : 477083
1 HUGO HGNC : 8579
1 IUPHAR : 2508
1 OMIM : 602344
1 Ensembl : ENSG00000158006
 
Sequence
Graphical view for this peptide sequence: human-PAFAH2
Colored MSA for PAF-Acetylhydrolase (raw)
MGVNQSVGFPPVTGPHLVGCGDVMEGQNLQGSFFRLFYPCQKAEETMEQP
LWIPRYEYCTGLAEYLQFNKRCGGLLFNLAVGSCRLPVSWNGPFKTKDSG
YPLIIFSHGLGAFRTLYSAFCMELASRGFVVAVPEHRDRSAATTYFCKQA
PEENQPTNESLQEEWIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQ
EVTAGQTVFNILPGGLDLMTLKGNIDMSRVAVMGHSFGGATAILALAKET
QFRCAVALDAWMFPLERDFYPKARGPVFFINTEKFQTMESVNLMKKICAQ
HEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMV
RAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGVNQSVGFPPVTGPHLVGCGDVMEGQNLQGSFFRLFYPCQKAEETMEQP
LWIPRYEYCTGLAEYLQFNKRCGGLLFNLAVGSCRLPVSWNGPFKTKDSG
YPLIIFSHGLGAFRTLYSAFCMELASRGFVVAVPEHRDRSAATTYFCKQA
PEENQPTNESLQEEWIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQ
EVTAGQTVFNILPGGLDLMTLKGNIDMSRVAVMGHSFGGATAILALAKET
QFRCAVALDAWMFPLERDFYPKARGPVFFINTEKFQTMESVNLMKKICAQ
HEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMV
RAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL

no DNA




References
5 more
    Title: Expression, purification and characterization of a human serine-dependent phospholipase A2 with high specificity for oxidized phospholipids and platelet activating factor
    Rice SQ, Southan C, Boyd HF, Terrett JA, Macphee CH, Moores K, Gloger IS, Tew DG
    Ref: Biochemical Journal, 330 ( Pt 3):1309, 1998 : PubMed

            

    Title: Platelet-activating factor acetylhydrolases
    Stafforini DM, McIntyre TM, Zimmerman GA, Prescott SM
    Ref: Journal of Biological Chemistry, 272:17895, 1997 : PubMed

            

    Title: cDNA cloning and expression of intracellular platelet-activating factor (PAF) acetylhydrolase II. Its homology with plasma PAF acetylhydrolase
    Hattori K, Adachi H, Matsuzawa A, Yamamoto K, Tsujimoto M, Aoki J, Hattori M, Arai H, Inoue K
    Ref: Journal of Biological Chemistry, 271:33032, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer