mouse-Ces1d

 
Mus musculus (Mouse) triacylglycerol hydrolase (tgh) Fatty acid ethyl ester synthase Carboxylesterase 3 (EC 3.1.1.1)

Comment
old human-hBr3 Genbank AB025028 Mori et al. WARNING this human sequence in database is soo close to mouse-Ces1d, not found in genome so is it a contamination or a file error? The human ortholog of mouse Ces3/TGH/Ces1d is CES1


Relationship
Block C
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic

Substrate: Retinol-palmitate ,
Inhibitor: WWL229 , WWL113 , ABP-C6 , NBD-HE-HP ,
>3 Genbank links 3 more: AF378751, AB025028, AB023631
1 UniProt : Q8VCT4
1 UniProtTrembl : Q8VCT4
1 Interpro : Q8VCT4
1 Prodom : Q8VCT4
1 Pfam : Q8VCT4
1 PIRSF : Q8VCT4
1 SUPERFAM : Q8VCT4
1 QuickSwissBlast : Q8VCT4
1 MGD : 2148202
2 ENSEMBL : Q924V8, ENSMUSG00000056973
 
Sequence
Graphical view for this peptide sequence: mouse-Ces1d
Colored MSA for Carb_B_Chordata (raw)
MRLYPLIWLSLAACTAWGYPSSPPVVNTVKGKVLGKYVNLEGFTQPVAVF
LGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTSYPPMCSQDAVGGQVLSEL
FTNRKENIPLQFSEDCLYLNIYTPADLTKNSRLPVMVWIHGGGLVVGGAS
TYDGLALSAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRW
VQDNIANFGGNPGSVTIFGESAGGFSVSVLVLSPLAKNLFHRAISESGVS
LTAALITTDVKPIAGLVATLSGCKTTTSAVMVHCLRQKTEDELLETSLKL
NLFKLDLLGNPKESYPFLPTVIDGVVLPKAPEEILAEKSFSTVPYIVGIN
KQEFGWIIPTLMGYPLAEGKLDQKTANSLLWKSYPTLKISENMIPVVAEK
YLGGTDDLTKKKDLFQDLMADVVFGVPSVIVSRSHRDAGASTYMYEFEYR
PSFVSAMRPKAVIGDHGDEIFSVFGSPFLKDGASEEETNLSKMVMKFWAN
FARNGNPNGGGLPHWPEYDQKEGYLKIGASTQAAQRLKDKEVSFWAELRA
KESAQRPSHREHVEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRLYPLIWLSLAACTAWGYPSSPPVVNTVKGKVLGKYVNLEGFTQPVAVF
LGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTSYPPMCSQDAVGGQVLSEL
FTNRKENIPLQFSEDCLYLNIYTPADLTKNSRLPVMVWIHGGGLVVGGAS
TYDGLALSAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRW
VQDNIANFGGNPGSVTIFGESAGGFSVSVLVLSPLAKNLFHRAISESGVS
LTAALITTDVKPIAGLVATLSGCKTTTSAVMVHCLRQKTEDELLETSLKL
NLFKLDLLGNPKESYPFLPTVIDGVVLPKAPEEILAEKSFSTVPYIVGIN
KQEFGWIIPTLMGYPLAEGKLDQKTANSLLWKSYPTLKISENMIPVVAEK
YLGGTDDLTKKKDLFQDLMADVVFGVPSVIVSRSHRDAGASTYMYEFEYR
PSFVSAMRPKAVIGDHGDEIFSVFGSPFLKDGASEEETNLSKMVMKFWAN
FARNGNPNGGGLPHWPEYDQKEGYLKIGASTQAAQRLKDKEVSFWAELRA
KESAQRPSHREHVEL

no DNA




References
11 more
    Title: A Unique Role of Carboxylesterase 3 (Ces3) in beta-Adrenergic Signaling-Stimulated Thermogenesis
    Yang L, Li X, Tang H, Gao Z, Zhang K, Sun K
    Ref: Diabetes, 68:1178, 2019 : PubMed

            

    Title: Integrated phenotypic and activity-based profiling links Ces3 to obesity and diabetes
    Dominguez E, Galmozzi A, Chang JW, Hsu KL, Pawlak J, Li W, Godio C, Thomas J, Partida D and Saez E <6 more author(s)>
    Ref: Nat Chemical Biology, 10:113, 2014 : PubMed

            

    Title: The cloning and expression of a murine triacylglycerol hydrolase cDNA and the structure of its corresponding gene
    Dolinsky VW, Sipione S, Lehner R, Vance DE
    Ref: Biochimica & Biophysica Acta, 1532:162, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer