mouse-hyes

 
Mus musculus soluble epoxide hydrolase 2, cytoplasmic (Ephx2), mRNA

Comment
C-terminal of Ephx2 has 20% identity with haloalkane dehalogenase and has the a/b hydrolase fold. The N-terminal part is homologous to bacterial haloacid dehalogenase. Q9DCW0 (now obsolete )and P3491 differ by one aa PfamA Abhydrolase_1 284 539


Relationship
Block X
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
4 structures (e.g. : 1CQZ, 1CR6, 1EK2... more)
No kinetic

Substrate: 19,20-EDP , TSO ,
Inhibitor: TUPS , Regorafenib , Sorafenib , SCHEMBL19358888 , B401 , t-AUCMB , t-MTUCB-NH , t-MTUCB , t-TUCB , CPU , CIU , CDU ,
>3 Genbank links 1 more: NM_007940, AK002415, AY098585
3 UniProt : P34914, Q3UQ71, A8JYK8
1 Ncbi-nid : 12832381
1 Ncbi-pid : 12832382
>3 Structure links 1 more: 1CQZ, 1CR6, 1EK2
3 UniProtTrembl : P34914, Q3UQ71, A8JYK8
3 Interpro : P34914, Q3UQ71, A8JYK8
3 Prodom : P34914, Q3UQ71, A8JYK8
3 Pfam : P34914, Q3UQ71, A8JYK8
3 PIRSF : P34914, Q3UQ71, A8JYK8
3 SUPERFAM : P34914, Q3UQ71, A8JYK8
3 QuickSwissBlast : P34914, Q3UQ71, A8JYK8
1 MGD : 99500
2 ENSEMBL : P34914, ENSMUSG00000022040
 
Sequence
Graphical view for this peptide sequence: mouse-hyes
Colored MSA for Epoxide_hydrolase (raw)
HGYVTVKPGIRLHFVEMGSGPALCLCHGFPESWFSWRYQIPALAQAGFRV
LAIDMKGYGDSSSPPEIEEYAMELLCKEMVTFLDKLGIPQAVFIGHDWAG
VMVWNMALFYPERVRAVASLNTPFMPPDPDVSPMKVIRSIPVFNYQLYFQ
EPGVAEAELEKNMSRTFKSFFRASDETGFIAVHKATEIGGILVNTPEDPN
LSKITTEEEIEFYIQQFKKTGFRGPLNWYRNTERNWKWSCKGLGRKILVP
ALMVTAEKDIVLRPEMSKNMEKWIPFLKRGHIEDCGHWTQIEKPTEVNQI
LIKWLQTEVQNPSVTSKI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

HGYVTVKPGIRLHFVEMGSGPALCLCHGFPESWFSWRYQIPALAQAGFRV
LAIDMKGYGDSSSPPEIEEYAMELLCKEMVTFLDKLGIPQAVFIGHDWAG
VMVWNMALFYPERVRAVASLNTPFMPPDPDVSPMKVIRSIPVFNYQLYFQ
EPGVAEAELEKNMSRTFKSFFRASDETGFIAVHKATEIGGILVNTPEDPN
LSKITTEEEIEFYIQQFKKTGFRGPLNWYRNTERNWKWSCKGLGRKILVP
ALMVTAEKDIVLRPEMSKNMEKWIPFLKRGHIEDCGHWTQIEKPTEVNQI
LIKWLQTEVQNPSVTSKI

Graphical view for this nucleotide DNA sequence (2042 bp): mouse-hyes



References
12 more
    Title: Hypoxia-Induced Neuroinflammation and Learning-Memory Impairments in Adult Zebrafish Are Suppressed by Glucosamine
    Lee Y, Lee S, Park JW, Hwang JS, Kim SM, Lyoo IK, Lee CJ, Han IO
    Ref: Molecular Neurobiology, 55:8738, 2018 : PubMed

            

    Title: Gene deficiency and pharmacological inhibition of soluble epoxide hydrolase confers resilience to repeated social defeat stress
    Ren Q, Ma M, Ishima T, Morisseau C, Yang J, Wagner KM, Zhang JC, Yang C, Yao W and Hashimoto K <3 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 113:E1944, 2016 : PubMed

            

    Title: Detoxification of environmental mutagens and carcinogens: structure, mechanism, and evolution of liver epoxide hydrolase
    Argiriadi MA, Morisseau C, Hammock BD, Christianson DW
    Ref: Proceedings of the National Academy of Sciences of the United States of America, 96:10637, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer