myctu-linb

 
Mycobacterium tuberculosis, Mycobacterium bovis, DHAA linb DhaA dmbA DmbA Rv2296 haloalkane dehalogenase (EC 3.8.1.5)

Comment
1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase. There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains.


Relationship
Block X
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
>3 Genbank links 39 more: Z77724, AAK46969, AJ243259
>3 UniProt links 3 more: Q9XB14, A1KLS7, C1AF48
1 Ncbi-nid : 3261620
1 Ncbi-pid : 1478233
3 Structure : 2QVB, 2O2H, 2O2I
>3 UniProtTrembl links 5 more: Q9XB14, A1KLS7, C1AF48
>3 Interpro links 5 more: Q9XB14, A1KLS7, C1AF48
>3 Prodom links 5 more: Q9XB14, A1KLS7, C1AF48
>3 Pfam links 5 more: Q9XB14, A1KLS7, C1AF48
>3 PIRSF links 5 more: Q9XB14, A1KLS7, C1AF48
>3 SUPERFAM links 5 more: Q9XB14, A1KLS7, C1AF48
>3 QuickSwissBlast links 5 more: Q9XB14, A1KLS7, C1AF48
 
Sequence
Graphical view for this peptide sequence: myctu-linb
Colored MSA for Haloalkane_dehalogenase-HLD2 (raw)
MTAFGVEPYGQPKYLEIAGKRMAYIDEGKGDAIVFQHGNPTSSYLWRNIM
PHLEGLGRLVACDLIGMGASDKLSPSGPDRYSYGEQRDFLFALWDALDLG
DHVVLVLHDWGSALGFDWANQHRDRVQGIAFMEAIVTPMTWADWPPAVRG
VFQGFRSPQGEPMALEHNIFVERVLPGAILRQLSDEEMNHYRRPFVNGGE
DRRPTLSWPRNLPIDGEPAEVVALVNEYRSWLEETDMPKLFINAEPGAII
TGRIRDYVRSWPNQTEITVPGVHFVQEDSPEEIGAAIAQFVRRLRSAAGV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTAFGVEPYGQPKYLEIAGKRMAYIDEGKGDAIVFQHGNPTSSYLWRNIM
PHLEGLGRLVACDLIGMGASDKLSPSGPDRYSYGEQRDFLFALWDALDLG
DHVVLVLHDWGSALGFDWANQHRDRVQGIAFMEAIVTPMTWADWPPAVRG
VFQGFRSPQGEPMALEHNIFVERVLPGAILRQLSDEEMNHYRRPFVNGGE
DRRPTLSWPRNLPIDGEPAEVVALVNEYRSWLEETDMPKLFINAEPGAII
TGRIRDYVRSWPNQTEITVPGVHFVQEDSPEEIGAAIAQFVRRLRSAAGV

Graphical view for this nucleotide DNA sequence (934 bp): myctu-linb



References
7 more
    Title: Substrate specificity of haloalkane dehalogenases
    Koudelakova T, Chovancova E, Brezovsky J, Monincova M, Fortova A, Jarkovsky J, Damborsky J
    Ref: Biochemical Journal, 435:345, 2011 : PubMed

            

    Title: X-ray crystal structure of Mycobacterium tuberculosis haloalkane dehalogenase Rv2579
    Mazumdar PA, Hulecki JC, Cherney MM, Garen CR, James MN
    Ref: Biochimica & Biophysica Acta, 1784:351, 2008 : PubMed

            

    Title: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence
    Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S and Barrell BG <32 more author(s)>
    Ref: Nature, 393:537, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer