human-NLGN4Y

 
Homo sapiens (Human) Neuroligin-4, Y-linked precursor (Neuroligin Y) KIAA0951

Comment
A new entry neuroligin Y4 neuroligin Y on chromosome Y Yq11.221 is created, it replace the entry human-42neur. Neuroligin4 is neuroligin X on chromosome X A6NMU8 Homo sapiens (Human) Neuroligin 4, Y-linked, isoform CRA_c


Relationship
Family Neuroligin
Block C
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
1 mutation: human-NLGN4Y
No structure
No kinetic
Disease: Neuroligin 4 Autism AUTSX2 Asperger syndrome ASPGX2 -


>3 Genbank links 8 more: AF376804, AB023168, BX537428
>3 UniProt links 2 more: Q8NFZ3, A6NMU8, B4DHI3
2 Ncbi-nid : 21309950, 29727048
2 Ncbi-pid : 21309951, 29727049
>3 UniProtTrembl links 2 more: Q8NFZ3, A6NMU8, B4DHI3
>3 Interpro links 2 more: Q8NFZ3, A6NMU8, B4DHI3
>3 Prodom links 2 more: Q8NFZ3, A6NMU8, B4DHI3
>3 Pfam links 2 more: Q8NFZ3, A6NMU8, B4DHI3
>3 PIRSF links 2 more: Q8NFZ3, A6NMU8, B4DHI3
>3 SUPERFAM links 2 more: Q8NFZ3, A6NMU8, B4DHI3
>3 QuickSwissBlast links 2 more: Q8NFZ3, A6NMU8, B4DHI3
1 EntrezGene : 22829
1 SNP : 22829
1 UniGene : 439199
1 HUGO HGNC : 15529
1 OMIM : 400028
1 Ensembl : ENSG00000165246
 
Sequence
Graphical view for this peptide sequence: human-NLGN4Y
Colored MSA for Neuroligin (raw)
MLRPQGLLWLPLLFTSVCVMLNSNVLLWITALAIKFTLIDSQAQYPVVNT
NYGKIQGLRTPLPSEILGPVEQYLGVPYASPPTGERRFQPPESPSSWTGI
RNATQFSAVCPQHLDERFLLHDMLPIWFTTSLDTLMTYVQDQNEDCLYLN
IYVPMEDDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVIT
INYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTI
FGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRIL
ADKVGCNMLDTTDMVECLKNKNYKELIQQTITPATYHIAFGPVIDGDVIP
DDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFSVS
NFVDNLYGYPEGKDTLRETIKFMYTDWADKENPETRRKTLVALFTDHQWV
APAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWADSAHGDEVPYVFGIP
MIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTK
PNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNL
NEIFQYVSTTTKVPPPDMTSFPYGTRRSPAKIWPTTKRPAITPANNPKHS
KDPHKTGPEDTTVLIETKRDYSTELSVTIAVGASLLFLNILAFAALYYKK
DKRRHETHRHPSPQRNTTNDITHIQNEEIMSLQMKQLEHDHECESLQAHD
TLRLTCPPDYTLTLRRSPDDIPFMTPNTITMIPNTLMGMQPLHTFKTFSG
GQNSTNLPHGHSTTRV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLRPQGLLWLPLLFTSVCVMLNSNVLLWITALAIKFTLIDSQAQYPVVNT
NYGKIQGLRTPLPSEILGPVEQYLGVPYASPPTGERRFQPPESPSSWTGI
RNATQFSAVCPQHLDERFLLHDMLPIWFTTSLDTLMTYVQDQNEDCLYLN
IYVPMEDDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVIT
INYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTI
FGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRIL
ADKVGCNMLDTTDMVECLKNKNYKELIQQTITPATYHIAFGPVIDGDVIP
DDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFSVS
NFVDNLYGYPEGKDTLRETIKFMYTDWADKENPETRRKTLVALFTDHQWV
APAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWADSAHGDEVPYVFGIP
MIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTK
PNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNL
NEIFQYVSTTTKVPPPDMTSFPYGTRRSPAKIWPTTKRPAITPANNPKHS
KDPHKTGPEDTTVLIETKRDYSTELSVTIAVGASLLFLNILAFAALYYKK
DKRRHETHRHPSPQRNTTNDITHIQNEEIMSLQMKQLEHDHECESLQAHD
TLRLTCPPDYTLTLRRSPDDIPFMTPNTITMIPNTLMGMQPLHTFKTFSG
GQNSTNLPHGHSTTRV

Graphical view for this nucleotide DNA sequence (2515 bp): human-NLGN4Y



References
7 more
    Title: Y chromosome gene copy number and lack of autism phenotype in a male with an isodicentric Y chromosome and absent NLGN4Y expression
    Ross JL, Bloy L, Roberts TPL, Miller J, Xing C, Silverman LA, Zinn AR
    Ref: American Journal of Medicine Genet B Neuropsychiatr Genet, 180:471, 2019 : PubMed

            

    Title: Constructing Bayesian networks by integrating gene expression and copy number data identifies NLGN4Y as a novel regulator of prostate cancer progression
    Gong Y, Wang L, Chippada-Venkata U, Dai X, Oh WK, Zhu J
    Ref: Oncotarget, 7:68688, 2016 : PubMed

            

    Title: Behavioral phenotypes in males with XYY and possible role of increased NLGN4Y expression in autism features
    Ross JL, Tartaglia N, Merry DE, Dalva M, Zinn AR
    Ref: Genes Brain Behav, 14:137, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer