Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-lipli

Mus musculus lipoprotein lipase

Relationship
Family|Lipoprotein_Lipase
Block| L
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 62 more: J03302, AK002645, AK017272
>3 UniProt links 8 more: P11152, Q4FJQ8, Q3U9P4
3 Ncbi-nid : 198849, 12832782, 12856426
>3 Ncbi-pid links 1 more: 387406, 110647, 12832783
>3 UniProt links 16 more: P11152, Q8C562, Q4FJQ8
>3 Interpro links 16 more: P11152, Q8C562, Q4FJQ8
>3 Prodom links 16 more: P11152, Q8C562, Q4FJQ8
>3 Pfam links 16 more: P11152, Q8C562, Q4FJQ8
>3 PIRSF links 16 more: P11152, Q8C562, Q4FJQ8
>3 SUPERFAM links 16 more: P11152, Q8C562, Q4FJQ8
1 MGD : 96820
2 ENSEMBL : P11152, ENSMUSG00000015568
Sequence
Graphical view for this peptide sequence: mouse-lipli
Colored MSA for Lipoprotein_Lipase (raw)
MESKALLLVVLGVWLQSLTAFRGGVAAADAGRDFSDIESKFALRTPEDTA
EDTCHLIPGLADSVSNCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALY
KREPDSNVIVVDWLYRAQQHYPVSAGYTKLVGNDVARFINWMEEEFNYPL
DNVHLLGYSLGAHAAGVAGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSP
DDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIR
VIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEKG
LCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFS
GTENGKQHNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIG
ELLMMKLKWMSDSYFSWPDWWSSPSFVIERIRVKAGETQKKVIFCAREKV
SHLQKGKDSAVFVKCHDKSLKKSG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MESKALLLVVLGVWLQSLTAFRGGVAAADAGRDFSDIESKFALRTPEDTA
EDTCHLIPGLADSVSNCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALY
KREPDSNVIVVDWLYRAQQHYPVSAGYTKLVGNDVARFINWMEEEFNYPL
DNVHLLGYSLGAHAAGVAGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSP
DDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIR
VIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEKG
LCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFS
GTENGKQHNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIG
ELLMMKLKWMSDSYFSWPDWWSSPSFVIERIRVKAGETQKKVIFCAREKV
SHLQKGKDSAVFVKCHDKSLKKSG


References
8 more
    Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
    Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R and Hayashizaki Y <127 more author(s)>
    Ref: Nature, 420:563, 2002 : PubMed

            

    Title: Normalization and subtraction of cap-trapper-selected cDNAs to prepare full-length cDNA libraries for rapid discovery of new genes
    Carninci P, Shibata Y, Hayatsu N, Sugahara Y, Shibata K, Itoh M, Konno H, Okazaki Y, Muramatsu M, Hayashizaki Y
    Ref: Genome Res, 10:1617, 2000 : PubMed

            

    Title: The sequence of cDNA encoding lipoprotein lipase. A member of a lipase gene family
    Kirchgessner TG, Svenson KL, Lusis AJ, Schotz MC
    Ref: Journal of Biological Chemistry, 262:8463, 1987 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer