Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-CES3

Homo sapiens (Human) Carboxylesterase 3 (Brain) Liver carboxylesterase 31 homolog

Comment
Previously human-lcxes Homo sapiens hypothetical protein FLJ21736 (FLJ21736), mRNA. Very close to the Chr4 human-cxes2 In reverse orientation separated by a gene of carbonic anhydrase


Relationship
Family|Carb_B_Chordata
Block| C
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
2 inhibitors: WWL113, WWL229
>3 Genbank links 5 more: XM_016735, AK097538, BC053670
2 UniProt : Q6UWW8, H3BUA3
1 Ncbi-nid : 14785624
1 Ncbi-pid : 14785625
>3 UniProt links 1 more: Q8N7Y3, Q6UWW8, H3BUA3
>3 Interpro links 1 more: Q8N7Y3, Q6UWW8, H3BUA3
>3 Prodom links 1 more: Q8N7Y3, Q6UWW8, H3BUA3
>3 Pfam links 1 more: Q8N7Y3, Q6UWW8, H3BUA3
>3 PIRSF links 1 more: Q8N7Y3, Q6UWW8, H3BUA3
>3 SUPERFAM links 1 more: Q8N7Y3, Q6UWW8, H3BUA3
1 EntrezGene : 23491
1 SNP : 23491
1 UniGene : 268700
1 HUGO HGNC : 1865
1 OMIM : 605279
1 Ensembl : ENSG00000172828
Sequence
Graphical view for this peptide sequence: human-CES3
Colored MSA for Carb_B_Chordata (raw)
MERAVRVESGVLVGVVCLLLACPATATGPEVAQPEVDTTLGRVRGRQVGV
KGTDRLVNVFLGIPFAQPPLGPDRFSAPHPAQPWEGVRDASTAPPMCLQD
VESMNSSRFVLNGKQQIFSVSEDCLVLNVYSPAEVPAGSGRPVMVWVHGG
ALITGAATSYDGSALAAYGDVVVVTVQYRLGVLGFFSTGDEHAPGNQGFL
DVVAALRWVQENIAPFGGDLNCVTVFGGSAGGSIISGLVLSPVAAGLFHR
AITQSGVITTPGIIDSHPWPLAQKIANTLACSSSSPAEMVQCLQQKEGEE
LVLSKKLKNTIYPLTVDGTVFPKSPKELLKEKPFHSVPFLMGVNNHEFSW
LIPRGWGLLDTMEQMSREDMLAISTPVLTSLDVPPEMMPTVIDEYLGSNS
DAQAKCQAFQEFMGDVFINVPTVSFSRYLRDSGSPVFFYEFQHRPSSFAK
IKPAWVKADHGAEGAFVFGGPFLMDESSRLAFPEATEEEKQLSLTMMAQW
THFARTGDPNSKALPPWPQFNQAEQYLEINPVPRAGQKFREAWMQFWSET
LPSKIQQWHQKQKNRKAQEDL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MERAVRVESGVLVGVVCLLLACPATATGPEVAQPEVDTTLGRVRGRQVGV
KGTDRLVNVFLGIPFAQPPLGPDRFSAPHPAQPWEGVRDASTAPPMCLQD
VESMNSSRFVLNGKQQIFSVSEDCLVLNVYSPAEVPAGSGRPVMVWVHGG
ALITGAATSYDGSALAAYGDVVVVTVQYRLGVLGFFSTGDEHAPGNQGFL
DVVAALRWVQENIAPFGGDLNCVTVFGGSAGGSIISGLVLSPVAAGLFHR
AITQSGVITTPGIIDSHPWPLAQKIANTLACSSSSPAEMVQCLQQKEGEE
LVLSKKLKNTIYPLTVDGTVFPKSPKELLKEKPFHSVPFLMGVNNHEFSW
LIPRGWGLLDTMEQMSREDMLAISTPVLTSLDVPPEMMPTVIDEYLGSNS
DAQAKCQAFQEFMGDVFINVPTVSFSRYLRDSGSPVFFYEFQHRPSSFAK
IKPAWVKADHGAEGAFVFGGPFLMDESSRLAFPEATEEEKQLSLTMMAQW
THFARTGDPNSKALPPWPQFNQAEQYLEINPVPRAGQKFREAWMQFWSET
LPSKIQQWHQKQKNRKAQEDL


References
6 more
    Title: A Unique Role of Carboxylesterase 3 (Ces3) in beta-Adrenergic Signaling-Stimulated Thermogenesis
    Yang L, Li X, Tang H, Gao Z, Zhang K, Sun K
    Ref: Diabetes, 68:1178, 2019 : PubMed

            

    Title: Integrated phenotypic and activity-based profiling links Ces3 to obesity and diabetes
    Dominguez E, Galmozzi A, Chang JW, Hsu KL, Pawlak J, Li W, Godio C, Thomas J, Partida D and Saez E <6 more author(s)>
    Ref: Nat Chemical Biology, 10:113, 2014 : PubMed

            

    Title: Hydrolysis of irinotecan and its oxidative metabolites, 7-ethyl-10-[4-N-(5-aminopentanoic acid)-1-piperidino] carbonyloxycamptothecin and 7-ethyl-10-[4-(1-piperidino)-1-amino]-carbonyloxycamptothecin, by human carboxylesterases CES1A1, CES2, and a newly expressed carboxylesterase isoenzyme, CES3
    Sanghani SP, Quinney SK, Fredenburg TB, Davis WI, Murry DJ, Bosron WF
    Ref: Drug Metabolism & Disposition: The Biological Fate of Chemicals, 32:505, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer