human-PREPL

 
Homo sapiens (Human) PREPL Prolylendopeptidase-like KIAA0436

Comment
PREPL is localized in the cytosol and shows homology with prolyl endopeptidase (PREP; 600400) and oligopeptidase B (EC 3.4.21.83). Jaeken et al. (2006) found that substitution of the predicted catalytic residues (ser470, asp556, and his601) by alanines resulted in loss of reactivity with a serine hydrolase-specific probe. In sharp contrast to PREP and oligopeptidase B, which require both amino- and carboxy-terminal sequences for activity, PREPL activity appeared to depend only on the carboxy-terminal domain. Jaeken et al. (2006) concluded that PREPL is a novel oligopeptidase with unique structural and functional characteristics. Trembl Q96DW7 is only a portion of this protein unknown (protein for mgc:21932)


Relationship
Block X
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
10 mutations: Table (ordered Natural and SD mutagenesis) (e.g. : DelA_human-PREPL, DelB_human-PREPL, DelC_human-PREPL ... more)
1 structure:
7OBM: Crystal structure of the human Prolyl Endopeptidase-Like protein short form (residues 90-727)
No kinetic
Disease: Hypotonia-Cystinuria Syndrome -
Substrate: Paranitrophenylthioacetate ,
Inhibitor: WHP313 , HDFP , Palmostatin-M , Palmostatin-B , SMR000042088 , PMSF ,
>3 Genbank links 7 more: AB007896, AC013717, AK131463
1 UniProt : Q4J6C6
1 Structure : 7OBM
1 UniProtTrembl : Q4J6C6
1 Interpro : Q4J6C6
1 Prodom : Q4J6C6
1 Pfam : Q4J6C6
1 PIRSF : Q4J6C6
1 SUPERFAM : Q4J6C6
1 QuickSwissBlast : Q4J6C6
1 EntrezGene : 9581
1 SNP : 9581
1 UniGene : 444349
1 HUGO HGNC : 30228
1 IUPHAR : 2870
2 OMIM : 606407, 609557
1 Ensembl : ENSG00000138078
 
Sequence
Graphical view for this peptide sequence: human-PREPL
Colored MSA for S9N_PREPL_Peptidase_S9 (raw)
AGLACGDTCSPLRASGSPACLHWFVSRAGLILSICDLQPVKQENEKPLPE
NMDAFEKVRTKLETQPQEEYEIINVEVKHGGFVYYQEGCCLVRSKDEEAD
NDNYEVLFNLEELKLDQPFIDCIRVAPDEKYVAAKIRTEDSEASTCVIIK
LSDQPVMEASFPNVSSFEWVKDEEDEDVLFYTFQRNLRCHDVYRATFGDN
KRNERFYTEKDPSYFVFLYLTKDSRFLTINIMNKTTSEVWLIDGLSPWDP
PVLIQKRIHGVLYYVEHRDDELYILTNVGEPTEFKLMRTAADTPAIMNWD
LFFTMKRNTKVIDLDMFKDHCVLFLKHSNLLYVNVIGLADDSVRSLKLPP
WACGFIMDTNSDPKNCPFQLCSPIRPPKYYTYKFAEGKLFEETGHEDPIT
KTSRVLRLEAKSKDGKLVPMTVFHKTDSEDLQKKPLLVHVYGAYGMDLKM
NFRPERRVLVDDGWILAYCHVRGGGELGLQWHADGRLTKKLNGLADLEAC
IKTLHGQGFSQPSLTTLTAFSAGGVLAGALCNSNPELVRAVTLEAPFLDV
LNTMMDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCPYQNIKPQHYPSIH
ITAYENDERVPLKGIVSYTEKLKEAIAEHAKDTGEGYQTPNIILDIQPGG
NHVIEDSHKKITAQIKFLYEELGLDSTSVFEDLKKYLKF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

AGLACGDTCSPLRASGSPACLHWFVSRAGLILSICDLQPVKQENEKPLPE
NMDAFEKVRTKLETQPQEEYEIINVEVKHGGFVYYQEGCCLVRSKDEEAD
NDNYEVLFNLEELKLDQPFIDCIRVAPDEKYVAAKIRTEDSEASTCVIIK
LSDQPVMEASFPNVSSFEWVKDEEDEDVLFYTFQRNLRCHDVYRATFGDN
KRNERFYTEKDPSYFVFLYLTKDSRFLTINIMNKTTSEVWLIDGLSPWDP
PVLIQKRIHGVLYYVEHRDDELYILTNVGEPTEFKLMRTAADTPAIMNWD
LFFTMKRNTKVIDLDMFKDHCVLFLKHSNLLYVNVIGLADDSVRSLKLPP
WACGFIMDTNSDPKNCPFQLCSPIRPPKYYTYKFAEGKLFEETGHEDPIT
KTSRVLRLEAKSKDGKLVPMTVFHKTDSEDLQKKPLLVHVYGAYGMDLKM
NFRPERRVLVDDGWILAYCHVRGGGELGLQWHADGRLTKKLNGLADLEAC
IKTLHGQGFSQPSLTTLTAFSAGGVLAGALCNSNPELVRAVTLEAPFLDV
LNTMMDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCPYQNIKPQHYPSIH
ITAYENDERVPLKGIVSYTEKLKEAIAEHAKDTGEGYQTPNIILDIQPGG
NHVIEDSHKKITAQIKFLYEELGLDSTSVFEDLKKYLKF

no DNA




References
18 more
    Title: PREPL, a prolyl endopeptidase-like enzyme by name only?--Lessons from patients
    Boonen K, Regal L, Jaeken J, Creemers JW
    Ref: CNS Neurol Disord Drug Targets, 10:355, 2011 : PubMed

            

    Title: Deletion of PREPL, a gene encoding a putative serine oligopeptidase, in patients with hypotonia-cystinuria syndrome
    Jaeken J, Martens K, Francois I, Eyskens F, Lecointre C, Derua R, Meulemans S, Slootstra JW, Waelkens E and Matthijs G <2 more author(s)>
    Ref: American Journal of Human Genetics, 78:38, 2006 : PubMed

            

    Title: The PREPL A protein, a new member of the prolyl oligopeptidase family, lacking catalytic activity
    Szeltner Z, Alshafee I, Juhasz T, Parvari R, Polgar L
    Ref: Cell Mol Life Sciences, 62:2376, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer