mouse-Ppgb

 
Mus musculus (Mouse) Lysosomal protective protein, Cathepsin A Ctsa, Protective protein for beta-galactosidase (Mo54) Ppgb

Relationship
Block X
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
7KDV: Murine core lysosomal multienzyme complex (LMC) composed of acid beta-galactosidase (GLB1) and protective protein cathepsin A (PPCA, CTSA)
No kinetic



>3 Genbank links 2 more: J05261, AK019861, AK032197
>3 UniProt links 3 more: P16675, Q9D2D1, Q544R6
2 Ncbi-nid : 200492, 12860233
2 Ncbi-pid : 200493, 12860234
1 Structure : 7KDV
>3 UniProtTrembl links 3 more: Q9D2D1, P16675, Q544R6
>3 Interpro links 3 more: Q9D2D1, P16675, Q544R6
>3 Prodom links 3 more: Q9D2D1, P16675, Q544R6
>3 Pfam links 3 more: Q9D2D1, P16675, Q544R6
>3 PIRSF links 3 more: Q9D2D1, P16675, Q544R6
>3 SUPERFAM links 3 more: Q9D2D1, P16675, Q544R6
>3 QuickSwissBlast links 3 more: Q9D2D1, P16675, Q544R6
1 MGD : 97748
2 ENSEMBL : P16675, ENSMUSG00000017760
 
Sequence
Graphical view for this peptide sequence: mouse-Ppgb
Colored MSA for Carboxypeptidase_S10 (raw)
MPGTALSPLLLLLLLSWASRNEAAPDQDEIDCLPGLAKQPSFRQYSGYLR
ASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQP
DGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYE
ALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVG
NGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCNFYDNKDPE
CVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHRYEDTLVVQDFGNIFT
RLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESL
PRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFM
GDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAG
HMVPTDKPRAAFTMFSRFLNKEPY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPGTALSPLLLLLLLSWASRNEAAPDQDEIDCLPGLAKQPSFRQYSGYLR
ASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQP
DGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYE
ALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVG
NGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCNFYDNKDPE
CVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHRYEDTLVVQDFGNIFT
RLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESL
PRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFM
GDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAG
HMVPTDKPRAAFTMFSRFLNKEPY

Graphical view for this nucleotide DNA sequence (2039 bp): mouse-Ppgb



References
9 more
    Title: Lysosomal Cathepsin A Plays a Significant Role in the Processing of Endogenous Bioactive Peptides
    Timur ZK, Akyildiz Demir S, Seyrantepe V
    Ref: Front Mol Biosci, 3:68, 2016 : PubMed

            

    Title: Cathepsin A regulates chaperone-mediated autophagy through cleavage of the lysosomal receptor
    Cuervo AM, Mann L, Bonten EJ, d'Azzo A, Dice JF
    Ref: EMBO Journal, 22:47, 2003 : PubMed

            

    Title: Mouse 'protective protein': cDNA cloning, sequence comparison, and expression
    Galjart NJ, Gillemans N, Meijer D, d'Azzo A
    Ref: Journal of Biological Chemistry, 265:4678, 1990 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer