mouse-rbbp9

 
Mus musculus (Mouse), Mus spretus (Western Mediterranean mouse), (Retinoblastoma-binding protein 9 protein) B5T overexpressed gene protein (bog protein)

Comment
Other strains: Mus musculus (Mouse), Mus spretus (Western Mediterranean mouse) (Algerian mouse)


Relationship
Block X
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 6 more: BC050201, AF039563, AK017606
>3 UniProt links 1 more: O88851, Q80YU9, A8QKA9
>3 UniProtTrembl links 1 more: O88851, Q80YU9, A8QKA9
>3 Interpro links 1 more: O88851, Q80YU9, A8QKA9
>3 Prodom links 1 more: O88851, Q80YU9, A8QKA9
>3 Pfam links 1 more: O88851, Q80YU9, A8QKA9
>3 PIRSF links 1 more: O88851, Q80YU9, A8QKA9
>3 SUPERFAM links 1 more: O88851, Q80YU9, A8QKA9
>3 QuickSwissBlast links 1 more: O88851, Q80YU9, A8QKA9
1 ENSEMBL : ENSMUSG00000027428
 
Sequence
Graphical view for this peptide sequence: mouse-rbbp9
Colored MSA for Hydrolase_RBBP9_YdeN (raw)
MASPNKAVIVPGNGGGDVATHGWYGWVKKGLEQIPGFQCLAKNMPDPITA
RESIWLPFMETELHCDEKTIIIGHSSGAIAAMRYAETHQVYALVLVSAYT
SDLGDENERASGYFSRPWQWEKIKANCPHIVQFGSTDDPFLPWKEQQEVA
DRLDAKLYKFTDRGHFQNTEFHELISVVKSMLKGPE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASPNKAVIVPGNGGGDVATHGWYGWVKKGLEQIPGFQCLAKNMPDPITA
RESIWLPFMETELHCDEKTIIIGHSSGAIAAMRYAETHQVYALVLVSAYT
SDLGDENERASGYFSRPWQWEKIKANCPHIVQFGSTDDPFLPWKEQQEVA
DRLDAKLYKFTDRGHFQNTEFHELISVVKSMLKGPE

no DNA




References
1 more
    Title: Identification of positional candidate genes for body weight and adiposity in subcongenic mice
    Chiu S, Kim K, Haus KA, Espinal GM, Millon LV, Warden CH
    Ref: Physiol Genomics, 31:75, 2007 : PubMed

            

    Title: A comparison of whole-genome shotgun-derived mouse chromosome 16 and the human genome
    Mural RJ, Adams MD, Myers EW, Smith HO, Miklos GL, Wides R, Halpern A, Li PW, Sutton GG and Stephenson LD <169 more author(s)>
    Ref: Science, 296:1661, 2002 : PubMed

            

    Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
    Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R and Hayashizaki Y <127 more author(s)>
    Ref: Nature, 420:563, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer