drome-ACHE

 
Drosophila melanogaster (Fruit fly) acetylcholinesterase H subunit

Comment
Cterminus H peptide Nucleotide sequence of the Celera sequence differs from the published sequence for this transcript. In particular as pointed out by P. Menozzi & D Fournier position 99 relative to initiation Methionine 99 is R (CGG) instead of G (GGG) Trembl Q8T0K7 GH25720p of Stapleton et al. only C term


Relationship
Family ACHE
Block C
Drosophila melanogaster position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > melanogaster group: N E > melanogaster subgroup: N E > Drosophila melanogaster: N E

Molecular evidence
Database
91 mutations: Table (ordered Natural and SD mutagenesis) (e.g. : P75L, Y109D, Y109G ... more)
6 structures (e.g. : 1QO9, 1DX4, 1QON... more)
No kinetic


Inhibitor: ZA , ZAI ,
>3 Genbank links 5 more: NP_476953, X05893, AE003699
2 UniProt : P07140, E1JIJ8
1 Ncbi-nid : 7532
1 Ncbi-pid : 7299734
>3 Structure links 3 more: 1QO9, 1DX4, 1QON
>3 UniProtTrembl links 2 more: O61551, Q8T0K7, P07140
>3 Interpro links 2 more: O61551, Q8T0K7, P07140
>3 Prodom links 2 more: O61551, Q8T0K7, P07140
>3 Pfam links 2 more: O61551, Q8T0K7, P07140
>3 PIRSF links 2 more: O61551, Q8T0K7, P07140
>3 SUPERFAM links 2 more: O61551, Q8T0K7, P07140
>3 QuickSwissBlast links 2 more: O61551, Q8T0K7, P07140
1 FlyBase : 0000024
 
Sequence
Graphical view for this peptide sequence: drome-ACHE
Colored MSA for ACHE (raw)
MAISCRQSRVLPMSLPLPLTIPLPLVLVLSLHLSGVCGVIDRLVVQTSSG
PVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATGL
SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
NGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
VIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
WNDYLPKVRSWAGTCDGDSGSASISPRLQLLGIAALIYICAALRTKRVF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAISCRQSRVLPMSLPLPLTIPLPLVLVLSLHLSGVCGVIDRLVVQTSSG
PVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATGL
SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
NGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
VIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
WNDYLPKVRSWAGTCDGDSGSASISPRLQLLGIAALIYICAALRTKRVF

Graphical view for this nucleotide DNA sequence (3567 bp): drome-ACHE



References
3 more
    Title: A Second Look at the Crystal Structures of Drosophila melanogaster Acetylcholinesterase in Complex with Tacrine Derivatives Provides Insights Concerning Catalytic Intermediates and the Design of Specific Insecticides
    Nachon F, Rosenberry TL, Silman I, Sussman JL
    Ref: Molecules, 25:1198, 2020 : PubMed

            

    Title: Annotation of the Drosophila melanogaster euchromatic genome: a systematic review
    Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH and Lewis SE <20 more author(s)>
    Ref: Genome Biol, 3:RESEARCH0083, 2002 : PubMed

            

    Title: The genome sequence of Drosophila melanogaster
    Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA and Venter JC <185 more author(s)>
    Ref: Science, 287:2185, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer