Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: drome-BEM46

Drosophila melanogaster (Fruit fly); Drosophila ficusphila bem46 CG18642 protein

Comment
Other strains: Drosophila melanogaster (Fruit fly); Drosophila ficusphila; Drosophila ananassae; Drosophila pseudoobscura pseudoobscura; Drosophila persimilis; Drosophila mojavensis; Drosophila navojoa; Drosophila grimshawi (Hawaiian) (Idiomyia grimshawi)


Relationship
Family|ABHD13-BEM46
Block| X
Position in NCBI Life Tree|Drosophila melanogaster
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > melanogaster group: N E > melanogaster subgroup: N E > Drosophila melanogaster: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 10 more: AE003581, AF069781, CH902620
>3 UniProt links 3 more: B3MMA4, Q29KH1, B4GS99
>3 UniProt links 18 more: O76462, B1PFW1, B1PFW2
>3 Interpro links 18 more: O76462, B1PFW1, B1PFW2
>3 Pfam links 18 more: O76462, B1PFW1, B1PFW2
>3 PIRSF links 18 more: O76462, B1PFW1, B1PFW2
>3 SUPERFAM links 18 more: O76462, B1PFW1, B1PFW2
1 FlyBase : 0025109
Sequence
Graphical view for this peptide sequence: drome-BEM46
Colored MSA for ABHD13-BEM46 (raw)
MKEVGIALPKSRGVGVGVLAAFLLCFIFYYFYGGYMTLALFAGIILLIFY
YAQDLLLYHPDLPANSRIYIPIPTMHNLPHITVSIKTPDDVTLHAFWVTQ
PEERSKSSPTLLYFHGNAGNMGHRMQNVWGIYHHLHCNVLMVEYRGYGLS
TGVPTERGLVTDARAAIDYLHTRHDLDHSQLILFGRSLGGAVVVDVAADT
VYGQKLMCAIVENTFSSIPEMAVELVHPAVKYIPNLLFKNKYHSMSKIGK
CSVPFLFISGLADNLVPPRMMRALYTKCGSEIKRLLEFPGGSHNDTWIVD
GYYQAIGGFLAELQQQPLLKAPEKSNVWVELEHKIIDV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKEVGIALPKSRGVGVGVLAAFLLCFIFYYFYGGYMTLALFAGIILLIFY
YAQDLLLYHPDLPANSRIYIPIPTMHNLPHITVSIKTPDDVTLHAFWVTQ
PEERSKSSPTLLYFHGNAGNMGHRMQNVWGIYHHLHCNVLMVEYRGYGLS
TGVPTERGLVTDARAAIDYLHTRHDLDHSQLILFGRSLGGAVVVDVAADT
VYGQKLMCAIVENTFSSIPEMAVELVHPAVKYIPNLLFKNKYHSMSKIGK
CSVPFLFISGLADNLVPPRMMRALYTKCGSEIKRLLEFPGGSHNDTWIVD
GYYQAIGGFLAELQQQPLLKAPEKSNVWVELEHKIIDV


References
1 more
    Title: Evolution of genes and genomes on the Drosophila phylogeny
    Clark AG, Eisen MB, Smith DR, Bergman CM, Oliver B, Markow TA, Kaufman TC, Kellis M, Gelbart W and MacCallum I <405 more author(s)>
    Ref: Nature, 450:203, 2007 : PubMed

            

    Title: Comparative genome sequencing of Drosophila pseudoobscura: chromosomal, gene, and cis-element evolution
    Richards S, Liu Y, Bettencourt BR, Hradecky P, Letovsky S, Nielsen R, Thornton K, Hubisz MJ, Chen R and Gibbs RA <42 more author(s)>
    Ref: Genome Res, 15:1, 2005 : PubMed

            

    Title: The genome sequence of Drosophila melanogaster
    Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA and Venter JC <185 more author(s)>
    Ref: Science, 287:2185, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer