mouse-Q8C1A9

 
Mus musculus (Mouse)3110057O12RIK Hypothetical alpha/beta-Hydrolases/putative DNA-binding domain

Comment
Q8C0I3 1 aa diff


Relationship
Family ABHD18
Block X
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 7 more: AK028580, BC145212, AK031032
>3 UniProt links 5 more: Q9CV37, B7ZNF5, Q921P1
>3 UniProtTrembl links 5 more: Q8C1A9, Q9CV37, B7ZNF5
>3 Interpro links 5 more: Q8C1A9, Q9CV37, B7ZNF5
>3 Prodom links 5 more: Q8C1A9, Q9CV37, B7ZNF5
>3 Pfam links 5 more: Q8C1A9, Q9CV37, B7ZNF5
>3 PIRSF links 5 more: Q8C1A9, Q9CV37, B7ZNF5
>3 SUPERFAM links 5 more: Q8C1A9, Q9CV37, B7ZNF5
>3 QuickSwissBlast links 5 more: Q8C1A9, Q9CV37, B7ZNF5
1 MGD : 1915468
1 ENSEMBL : ENSMUSG00000037818
 
Sequence
Graphical view for this peptide sequence: mouse-Q8C1A9
Colored MSA for ABHD18 (raw)
MGVSKLDILYRRLLLTKLFIRGWGRPEDLKRLFEFRKMIGNRERCQNLVS
SDYPVHIDKVEEQSDCKILDGHFVSPMAHYVPGIMPIESVVARFQFIVPK
EWNSRYRPVCIHLAGTGDHHYWRRRTLMARPMIKEARMASLLLENPYYGC
RKPKDQVRSSLKNVSDLFVMGGALILESAALLHWLEREGYGPLGMTGISM
GGHMASLAVSNWPKPMPLIPCLSWSTASGVFTTGVLSKSINWRELEKQYY
TQTVYEEEIIHMLEYCGTDSFKMGHEFMNHLPSNADKLTNLNLVSRTLNL
DMTDQVVSPKDAKCHKSGKTSISAPSNGQLLQDTAKMECLNQTLSTNKSW
FASYNPQSFHLLNREQRRSNRQKESLIFMKGVMDECTHVANFSVPVDPSL
IIVVQAKEDAYIPRTGVRSLQEIWPGCEIRYLEGGHISAYLFKQGLFRQA
IYDAFERFLHKYAN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGVSKLDILYRRLLLTKLFIRGWGRPEDLKRLFEFRKMIGNRERCQNLVS
SDYPVHIDKVEEQSDCKILDGHFVSPMAHYVPGIMPIESVVARFQFIVPK
EWNSRYRPVCIHLAGTGDHHYWRRRTLMARPMIKEARMASLLLENPYYGC
RKPKDQVRSSLKNVSDLFVMGGALILESAALLHWLEREGYGPLGMTGISM
GGHMASLAVSNWPKPMPLIPCLSWSTASGVFTTGVLSKSINWRELEKQYY
TQTVYEEEIIHMLEYCGTDSFKMGHEFMNHLPSNADKLTNLNLVSRTLNL
DMTDQVVSPKDAKCHKSGKTSISAPSNGQLLQDTAKMECLNQTLSTNKSW
FASYNPQSFHLLNREQRRSNRQKESLIFMKGVMDECTHVANFSVPVDPSL
IIVVQAKEDAYIPRTGVRSLQEIWPGCEIRYLEGGHISAYLFKQGLFRQA
IYDAFERFLHKYAN

no DNA




References
    Title: Lineage-specific biology revealed by a finished genome assembly of the mouse
    Church DM, Goodstadt L, Hillier LW, Zody MC, Goldstein S, She X, Bult CJ, Agarwala R, Cherry JL and Ponting CP <21 more author(s)>
    Ref: PLoS Biol, 7:e1000112, 2009 : PubMed

            

    Title: A comparison of whole-genome shotgun-derived mouse chromosome 16 and the human genome
    Mural RJ, Adams MD, Myers EW, Smith HO, Miklos GL, Wides R, Halpern A, Li PW, Sutton GG and Stephenson LD <169 more author(s)>
    Ref: Science, 296:1661, 2002 : PubMed

            

    Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
    Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R and Hayashizaki Y <127 more author(s)>
    Ref: Nature, 420:563, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer