bacsu-pnbae

 
Bacillus subtilis, Bacillus sp., EH84 para-nitrobenzyl esterase (pnbA) intracellular esterase B CarEW

Comment
EH84 promiscuous activity 13/96 substrates Martinez-Martinez et al. 2018. hydrolyzes polyethyleneterephthalate Other strains: Bacillus subtilis (NRRL B8079; subsp. spizizenii ATCC 6633; subsp. natto BEST195 strain ATCC 23059 / NRRL B-1447/ W23; RO-NN-1; QB928; BSP1; BEST7613 ;MB73/2; BEST7003; XF-1; PY79; QH-1; E1; TO-A; Miyagi-4) Bacillus sp.( WBC-3; EGD-AK10; Za); subsp. subtilis str. (SC-8; BAB-1; 6051-HGW; JH642 substr. AG174; OH 131.1; AG1839); subsp. spizizenii TU-B-10; Streptococcus pneumoniae; Bacillus licheniformis; Bacillus sp.


Relationship
Block C
Bacillus subtilis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
3 mutations: Table (ordered Natural and SD mutagenesis)A107H, A107K, A107K/A190C
3 structures: 1C7J, 1QE3, 1C7I
No kinetic

Substrate: Paranitrobenzylacetate~PNBA , Polyethylene-terephthalate , Dibutyl-phthalate ,

>3 Genbank links 50 more: QHH21706, NP_391319, AIZ00845
>3 UniProt links 8 more: Q2XU60, P37967, E0U2Z6
1 Ncbi-nid : 468045 1495277
3 Structure : 1C7J, 1QE3, 1C7I
>3 UniProtTrembl links 15 more: Q2XU60, P37967, E0U2Z6
>3 Interpro links 15 more: Q2XU60, P37967, E0U2Z6
>3 Prodom links 15 more: Q2XU60, P37967, E0U2Z6
>3 Pfam links 15 more: Q2XU60, P37967, E0U2Z6
>3 PIRSF links 15 more: Q2XU60, P37967, E0U2Z6
>3 SUPERFAM links 15 more: Q2XU60, P37967, E0U2Z6
>3 QuickSwissBlast links 15 more: Q2XU60, P37967, E0U2Z6
 
Sequence
Graphical view for this peptide sequence: bacsu-pnbae
Colored MSA for Carb_B_Bacteria (raw)
MTHQIVTTQYGKVKGTTENGVHKWKGIPYAKPPVGQWRFKAPEPPEVWED
VLDATAYGPICPQPSDLLSLSYTELPRQSEDCLYVNVFAPDTPSQNLPVM
VWIHGGAFYLGAGSEPLYDGSKLAAQGEVIVVTLNYRLGPFGFLHLSSFD
EAYSDNLGLLDQAAALKWVRENISAFGGDPDNVTVFGESAGGMSIAALLA
MPAAKGLFQKAIMESGASRTMTKEQAASTAAAFLQVLGINESQLDRLHTV
AAEDLLKAADQLRIAEKENIFQLFFQPALDPKTLPEEPEKSIAEGAASGI
PLLIGTTRDEGYLFFTPDSDVHSQETLDAALEYLLGKPLAEKAADLYPRS
LESQIHMMTDLLFWRPAVAYASAQSHYAPVWMYRFDWHPEKPPYNKAFHA
LELPFVFGNLDGLERMAKAEITDEVKQLSHTIQSAWITFAKTGNPSTEAV
NWPAYHEETRETVILDSEITIENDPESEKRQKLFPSKGE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTHQIVTTQYGKVKGTTENGVHKWKGIPYAKPPVGQWRFKAPEPPEVWED
VLDATAYGPICPQPSDLLSLSYTELPRQSEDCLYVNVFAPDTPSQNLPVM
VWIHGGAFYLGAGSEPLYDGSKLAAQGEVIVVTLNYRLGPFGFLHLSSFD
EAYSDNLGLLDQAAALKWVRENISAFGGDPDNVTVFGESAGGMSIAALLA
MPAAKGLFQKAIMESGASRTMTKEQAASTAAAFLQVLGINESQLDRLHTV
AAEDLLKAADQLRIAEKENIFQLFFQPALDPKTLPEEPEKSIAEGAASGI
PLLIGTTRDEGYLFFTPDSDVHSQETLDAALEYLLGKPLAEKAADLYPRS
LESQIHMMTDLLFWRPAVAYASAQSHYAPVWMYRFDWHPEKPPYNKAFHA
LELPFVFGNLDGLERMAKAEITDEVKQLSHTIQSAWITFAKTGNPSTEAV
NWPAYHEETRETVILDSEITIENDPESEKRQKLFPSKGE

Graphical view for this nucleotide DNA sequence (1513 bp): bacsu-pnbae



References
21 more
    Title: Development of a whole-cell biocatalyst for diisobutyl phthalate degradation by functional display of a carboxylesterase on the surface of Escherichia coli
    Ding J, Zhou Y, Wang C, Peng Z, Mu Y, Tang X, Huang Z
    Ref: Microb Cell Fact, 19:114, 2020 : PubMed

            

    Title: Determinants and prediction of esterase substrate promiscuity patterns
    Martinez-Martinez M, Coscolin C, Santiago G, Chow J, Stogios PJ, Bargiela R, Gertler C, Navarro-Fernandez J, Bollinger A and Ferrer M <32 more author(s)>
    Ref: ACS Chemical Biology, 13:225, 2018 : PubMed

            

    Title: Properties of a newly identified esterase from Bacillus sp. K91 and its novel function in diisobutyl phthalate degradation
    Ding J, Wang C, Xie Z, Li J, Yang Y, Mu Y, Tang X, Xu B, Zhou J, Huang Z
    Ref: PLoS ONE, 10:e0119216, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer