drome-GH02439

 
Drosophila melanogaster (Fruit fly); D. ananassae; D. virilis; Drosophila willistoni; Drosophila yakuba D. pseudoobscura; D. persimilis gh19206p gh02439

Comment
Other strains: Drosophila ananassae; Drosophila virilis; Drosophila willistoni; Drosophila yakuba; Drosophila pseudoobscura pseudoobscura; Drosophila persimilis Q9VNH7 Q9Y164 Q95T61 probable alternative splicing


Relationship
Family Ndr_family
Block X
Drosophila melanogaster position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > melanogaster group: N E > melanogaster subgroup: N E > Drosophila melanogaster: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 46 more: AY060319, AE003601, AF145604
>3 UniProt links 4 more: Q59E07, Q95T61, Q8IPR0
>3 UniProtTrembl links 27 more: Q95T61, Q8IPR0, Q59E07
>3 Interpro links 27 more: Q95T61, Q8IPR0, Q59E07
>3 Prodom links 27 more: Q95T61, Q8IPR0, Q59E07
>3 Pfam links 27 more: Q95T61, Q8IPR0, Q59E07
>3 PIRSF links 27 more: Q95T61, Q8IPR0, Q59E07
>3 SUPERFAM links 27 more: Q95T61, Q8IPR0, Q59E07
>3 QuickSwissBlast links 27 more: Q95T61, Q8IPR0, Q59E07
1 FlyBase : 0027608
 
Sequence
Graphical view for this peptide sequence: drome-GH02439
Colored MSA for Ndr_family (raw)
MSKPGTPKHGAGSSSAAAAPEKISKYNISTEKCGDLTVIVQGDLSQQEKR
AVFITVHDLGCNHNSFQEFVSSPCMTEIKERSCFIHVDVPGHADNAEALA
DGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRV
LGLILINATGSAASVVQSFKNKFISWKSDEVAQSAESFLMYHKFGHVMEQ
IVGENPDKEKIVAEYQKRLHRSLNSKNIGLYVKAFMNRKDLTLKGCKVDV
ILITGMLSPYASMVEKLHRDVEKERVTILKIERAGDVLADAPGKVAQSIL
LFCKGQGLLTSVVMPGVDRGRAFSTASSGSLEGANGSRRLSRGISMEDYD
KPNIRRLSIMNSELPKKE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSKPGTPKHGAGSSSAAAAPEKISKYNISTEKCGDLTVIVQGDLSQQEKR
AVFITVHDLGCNHNSFQEFVSSPCMTEIKERSCFIHVDVPGHADNAEALA
DGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRV
LGLILINATGSAASVVQSFKNKFISWKSDEVAQSAESFLMYHKFGHVMEQ
IVGENPDKEKIVAEYQKRLHRSLNSKNIGLYVKAFMNRKDLTLKGCKVDV
ILITGMLSPYASMVEKLHRDVEKERVTILKIERAGDVLADAPGKVAQSIL
LFCKGQGLLTSVVMPGVDRGRAFSTASSGSLEGANGSRRLSRGISMEDYD
KPNIRRLSIMNSELPKKE

no DNA




References
2 more
    Title: Evolution of genes and genomes on the Drosophila phylogeny
    Clark AG, Eisen MB, Smith DR, Bergman CM, Oliver B, Markow TA, Kaufman TC, Kellis M, Gelbart W and MacCallum I <405 more author(s)>
    Ref: Nature, 450:203, 2007 : PubMed

            

    Title: Comparative genome sequencing of Drosophila pseudoobscura: chromosomal, gene, and cis-element evolution
    Richards S, Liu Y, Bettencourt BR, Hradecky P, Letovsky S, Nielsen R, Thornton K, Hubisz MJ, Chen R and Gibbs RA <42 more author(s)>
    Ref: Genome Res, 15:1, 2005 : PubMed

            

    Title: The genome sequence of Drosophila melanogaster
    Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA and Venter JC <185 more author(s)>
    Ref: Science, 287:2185, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer