human-LYPLAL1

 
Homo sapiens (Human) LYPLAL1 26.3 kda protein lysophospholipase-like 1

Relationship
Block X
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
>3 Genbank links 3 more: AL360093, BC016711, AY341430
3 UniProt : Q5VWZ2, Q5VWZ2, B3KVW3
2 Structure : 5KRE, 3U0V
2 UniProtTrembl : Q5VWZ2, B3KVW3
2 Interpro : Q5VWZ2, B3KVW3
2 Prodom : Q5VWZ2, B3KVW3
2 Pfam : Q5VWZ2, B3KVW3
2 PIRSF : Q5VWZ2, B3KVW3
2 SUPERFAM : Q5VWZ2, B3KVW3
2 QuickSwissBlast : Q5VWZ2, B3KVW3
1 EntrezGene : 127018
1 SNP : 127018
1 UniGene : 657617
1 HUGO HGNC : 20440
1 OMIM : 616548
1 Ensembl : ENSG00000143353
 
Sequence
Graphical view for this peptide sequence: human-LYPLAL1
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLT
FQHIKIIYPTAPPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQV
LTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFALSSF
LNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSLGVT
TKFHSFPNVYHELSKTELDILKLWILTKLPGEMEKQK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLT
FQHIKIIYPTAPPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQV
LTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFALSSF
LNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSLGVT
TKFHSFPNVYHELSKTELDILKLWILTKLPGEMEKQK

no DNA




References
6 more
    Title: Discovery of a Selective Covalent Inhibitor of Lysophospholipase-like 1 (LYPLAL1) as a Tool to Evaluate the Role of this Serine Hydrolase in Metabolism
    Ahn K, Boehm M, Brown MF, Calloway J, Che Y, Chen J, Fennell KF, Geoghegan KF, Gilbert AM and Yan J <19 more author(s)>
    Ref: ACS Chemical Biology, 11:2529, 2016 : PubMed

            

    Title: Crystal structure of the predicted phospholipase LYPLAL1 reveals unexpected functional plasticity despite close relationship to acyl protein thioesterases
    Burger M, Zimmermann TJ, Kondoh Y, Stege P, Watanabe N, Osada H, Waldmann H, Vetter IR
    Ref: J Lipid Res, 53:43, 2012 : PubMed

            

    Title: The DNA sequence and biological annotation of human chromosome 1
    Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K and Prigmore E <169 more author(s)>
    Ref: Nature, 441:315, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer