Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-abhd5

Mus musculus (Mouse) cgi-58 RIKEN AK004873 gene

Relationship
Family|CGI-58_ABHD5_ABHD4
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
1 mutation: mouse-abhd5
No structure
No kinetic





No Substrate
6 inhibitors (e.g. : ABP-C6, NBD-HE-HP, SR-3133... more)
>3 Genbank links 3 more: AK004873, AK019488, BC006683
2 UniProt : Q9DBL9, D3Z7K3
1 Ncbi-nid : 12836384
1 Ncbi-pid : 12836385
3 UniProt : Q9DBL9, Q922Z5, D3Z7K3
3 Interpro : Q9DBL9, Q922Z5, D3Z7K3
3 Prodom : Q9DBL9, Q922Z5, D3Z7K3
3 Pfam : Q9DBL9, Q922Z5, D3Z7K3
3 PIRSF : Q9DBL9, Q922Z5, D3Z7K3
3 SUPERFAM : Q9DBL9, Q922Z5, D3Z7K3
1 MGD : 1914719
2 ENSEMBL : Q9DBL9, ENSMUSG00000032540
Sequence
Graphical view for this peptide sequence: mouse-abhd5
Colored MSA for CGI-58_ABHD5_ABHD4 (raw)
MKAMAAEEEVDSADAGGGSGWLTGWLPTWCPTSTSHLKEAEEKMLKCVPC
TYKKEPVRISNGNRIWTLMFSHNISSKTPLVLLHGFGGGLGLWALNFEDL
STDRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALRLDKMI
LLGHNLGGFLAAAYSLKYPSRVSHLILVEPWGFPERPDLADQERPIPVWI
RALGAALTPFNPLAGLRIAGPFGLSLVQRLRPDFKRKYSSMFEDDTVTEY
IYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGGLHPDIPVSVIFGARS
CIDGNSGTSIQSLRPKSYVKTIAILGAGHYVYADQPEEFNQKVKEICHTV
D
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKAMAAEEEVDSADAGGGSGWLTGWLPTWCPTSTSHLKEAEEKMLKCVPC
TYKKEPVRISNGNRIWTLMFSHNISSKTPLVLLHGFGGGLGLWALNFEDL
STDRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALRLDKMI
LLGHNLGGFLAAAYSLKYPSRVSHLILVEPWGFPERPDLADQERPIPVWI
RALGAALTPFNPLAGLRIAGPFGLSLVQRLRPDFKRKYSSMFEDDTVTEY
IYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGGLHPDIPVSVIFGARS
CIDGNSGTSIQSLRPKSYVKTIAILGAGHYVYADQPEEFNQKVKEICHTV
D


References
14 more
    Title: ABHD5-A Regulator of Lipid Metabolism Essential for Diverse Cellular Functions
    Schratter M, Lass A, Radner FPW
    Ref: Metabolites, 12:1015, 2022 : PubMed

            

    Title: Molecular Modeling of ABHD5 Structure and Ligand Recognition
    Shahoei R, Pangeni S, Sanders MA, Zhang H, Mladenovic-Lucas L, Roush WR, Halvorsen G, Kelly CV, Granneman JG, Huang YM
    Ref: Front Mol Biosci, 9:935375, 2022 : PubMed

            

    Title: Novel Pharmacological Probes Reveal ABHD5 as a Locus of Lipolysis Control in White and Brown Adipocytes
    Rondini EA, Mladenovic-Lucas L, Roush WR, Halvorsen GT, Green AE, Granneman JG
    Ref: Journal of Pharmacology & Experimental Therapeutics, 363:367, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer