Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-ABHD11

Homo sapiens (Human) (EC 3.3.2.3) Abhydrolase domain-containing protein 11 williams-beuren syndrome critical region protein 21

Comment
No amidase/protease, phosphatase, sulfatase, phospholipase C or phosphodiesterase activity. No activity of hABHD11 towards mono- or diacylglycerols. ABHD11 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. ABHD11 is an enzyme acting on triacylglycerol. Many yeasts are able to produce ethyl acetate. Enzyme Eat1 from the yeast Wickerhamomyces anomalus showed alcohol acetyltransferase activity with ethanol and acetyl-CoA. Homologs of eat1 are responsible for most ethyl acetate synthesis in known ethyl acetate-producing yeasts, including S. cerevisiae, and are only distantly related to known alcohol acetyltransferases. Structure of ybfF protein from Escherichia coli (esterase of the large substrates, palmitoyl coenzyme A and malonyl coenzyme A) has been solved. Liu et al. published that: ABHD11 is critical for embryonic stem cell expansion, differentiation and lipid metabolic homeostasis. ABHD11-AS1 is An Emerging Long Non-Coding RNA (lncRNA) with Clinical Significance in Human Malignancies


Relationship
Family|ABHD11-Acetyl_transferase
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
2 inhibitors: ML211, ML226
Sequence
Graphical view for this peptide sequence: human-ABHD11
Colored MSA for ABHD11-Acetyl_transferase (raw)
MRAGQQLASMLRWTRAWRLPREGLGPHGPSFARVPVAPSSSSGGRGGAEP
RLLDGEAALPAVVFLHGLFGSKTNFNSIAKILAQQTGRRVLTVDARNHGD
SPHSPDMSYEIMSQDLQDLLPQLGLVPCVVVGHSMGGKTAMLLALQRPEL
VERLIAVDISPVESTGVSHFATYVAAMRAINIADELPRSRARKLADEQLS
SVIQDMAVRQHLLTNLVEVDGRFVWRVNLDALTQHLDKILAFPQRQESYL
GPTLFLLGGNSQFVHPSHHPEIMRLFPRAQMQTVPNAGHWIHADRPQDFI
AAIRGFLV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRAGQQLASMLRWTRAWRLPREGLGPHGPSFARVPVAPSSSSGGRGGAEP
RLLDGEAALPAVVFLHGLFGSKTNFNSIAKILAQQTGRRVLTVDARNHGD
SPHSPDMSYEIMSQDLQDLLPQLGLVPCVVVGHSMGGKTAMLLALQRPEL
VERLIAVDISPVESTGVSHFATYVAAMRAINIADELPRSRARKLADEQLS
SVIQDMAVRQHLLTNLVEVDGRFVWRVNLDALTQHLDKILAFPQRQESYL
GPTLFLLGGNSQFVHPSHHPEIMRLFPRAQMQTVPNAGHWIHADRPQDFI
AAIRGFLV


References
31 more
    Title: ABHD11 maintains 2-oxoglutarate metabolism by preserving functional lipoylation of the 2-oxoglutarate dehydrogenase complex
    Bailey PSJ, Ortmann BM, Martinelli AW, Houghton JW, Costa ASH, Burr SP, Antrobus R, Frezza C, Nathan JA
    Ref: Nat Commun, 11:4046, 2020 : PubMed

            

    Title: ABHD11, a new diacylglycerol lipase involved in weight gain regulation
    Escoubet J, Kenigsberg M, Derock M, Yaligara V, Bock MD, Roche S, Massey F, de Foucauld H, Bettembourg C and Guillemot JC <22 more author(s)>
    Ref: PLoS ONE, 15:e0234780, 2020 : PubMed

            

    Title: ABHD11 Is Critical for Embryonic Stem Cell Expansion, Differentiation and Lipid Metabolic Homeostasis
    Liu G, Ruan Y, Zhang J, Wang X, Wu W, He P, Wang J, Xiong J, Cheng Y and Jian R <3 more author(s)>
    Ref: Front Cell Developmental Biology, 8:570, 2020 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer