Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-ABHD11

Homo sapiens (Human) (EC 3.3.2.3) Abhydrolase domain-containing protein 11 williams-beuren syndrome critical region protein 21

Comment
No amidase/protease, phosphatase, sulfatase, phospholipase C or phosphodiesterase activity. No activity of hABHD11 towards mono- or diacylglycerols.


Relationship
Family|ABHD11-Acetyl_transferase
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
2 inhibitors: ML211, ML226
Sequence
Graphical view for this peptide sequence: human-ABHD11
Colored MSA for ABHD11-Acetyl_transferase (raw)
MRAGQQLASMLRWTRAWRLPREGLGPHGPSFARVPVAPSSSSGGRGGAEP
RLLDGEAALPAVVFLHGLFGSKTNFNSIAKILAQQTGRRVLTVDARNHGD
SPHSPDMSYEIMSQDLQDLLPQLGLVPCVVVGHSMGGKTAMLLALQRPEL
VERLIAVDISPVESTGVSHFATYVAAMRAINIADELPRSRARKLADEQLS
SVIQDMAVRQHLLTNLVEVDGRFVWRVNLDALTQHLDKILAFPQRQESYL
GPTLFLLGGNSQFVHPSHHPEIMRLFPRAQMQTVPNAGHWIHADRPQDFI
AAIRGFLV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRAGQQLASMLRWTRAWRLPREGLGPHGPSFARVPVAPSSSSGGRGGAEP
RLLDGEAALPAVVFLHGLFGSKTNFNSIAKILAQQTGRRVLTVDARNHGD
SPHSPDMSYEIMSQDLQDLLPQLGLVPCVVVGHSMGGKTAMLLALQRPEL
VERLIAVDISPVESTGVSHFATYVAAMRAINIADELPRSRARKLADEQLS
SVIQDMAVRQHLLTNLVEVDGRFVWRVNLDALTQHLDKILAFPQRQESYL
GPTLFLLGGNSQFVHPSHHPEIMRLFPRAQMQTVPNAGHWIHADRPQDFI
AAIRGFLV


References
10 more
    Title: ABHD11 Is Critical for Embryonic Stem Cell Expansion, Differentiation and Lipid Metabolic Homeostasis
    Liu G, Ruan Y, Zhang J, Wang X, Wu W, He P, Wang J, Xiong J, Cheng Y and Jian R <3 more author(s)>
    Ref: Front Cell Developmental Biology, 8:570, 2020 : PubMed

            

    Title: Human alpha beta hydrolase domain containing protein 11 and its yeast homolog are lipid hydrolases
    Arya M, Srinivasan M, Rajasekharan R
    Ref: Biochemical & Biophysical Research Communications, 487:875, 2017 : PubMed

            

    Title: Chemoproteomic, biochemical and pharmacological approaches in the discovery of inhibitors targeting human alpha/beta-hydrolase domain containing 11 (ABHD11)
    Navia-Paldanius D, Patel JZ, Lopez Navarro M, Jakupovic H, Goffart S, Pasonen-Seppanen S, Nevalainen TJ, Jaaskelainen T, Laitinen T and Savinainen JR <1 more author(s)>
    Ref: Eur J Pharm Sci, 93:253, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer