mouse-SERHL

 
Mus musculus (Mouse) serine hydrolase-like protein 0610008b10rik protein and isoforms shl-2 (1110019m09rik protein)

Relationship
Family SERHL
Block X
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 8 more: AK002313, AJ251200, AJ245737
>3 UniProt links 1 more: Q9EPB5, Q3U3G8, E9Q8E7
>3 UniProtTrembl links 3 more: Q9EPB5, Q80XK9, Q3U3G8
>3 Interpro links 3 more: Q9EPB5, Q80XK9, Q3U3G8
>3 Prodom links 3 more: Q9EPB5, Q80XK9, Q3U3G8
>3 Pfam links 3 more: Q9EPB5, Q80XK9, Q3U3G8
>3 PIRSF links 3 more: Q9EPB5, Q80XK9, Q3U3G8
>3 SUPERFAM links 3 more: Q9EPB5, Q80XK9, Q3U3G8
>3 QuickSwissBlast links 3 more: Q9EPB5, Q80XK9, Q3U3G8
1 MGD : 1890404
2 ENSEMBL : Q9EPB5, ENSMUSG00000058586
 
Sequence
Graphical view for this peptide sequence: mouse-SERHL
Colored MSA for SERHL (raw)
MGLHSELKLAVPWGHIALKVWGSQKNPPVLCLHGWLDNANSFDRLIPLLP
QDFCYMAMDFGGHGLSSHYNPGLPYYQQNFVSEVRRVATAFKWNQFTLLG
HSFGGCVGGTFACMFPEMVDKLILLDSTPFFLDSNEMENILTYRRRNIEH
TLQVEASQKKSLRAVSPEEMLQGFLNNNSHLDKDCGELILQRGTTKVDAG
LVLNRDRRISWPENSFDFVSKEMFVHSAKSLQASVLMIKALQGYYDVRRA
NDADKAPMHFMVDTLRSTLKERFQFVEVPGNHYIHMNKPQVVAGVVGPFL
QGLQRMTSARL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGLHSELKLAVPWGHIALKVWGSQKNPPVLCLHGWLDNANSFDRLIPLLP
QDFCYMAMDFGGHGLSSHYNPGLPYYQQNFVSEVRRVATAFKWNQFTLLG
HSFGGCVGGTFACMFPEMVDKLILLDSTPFFLDSNEMENILTYRRRNIEH
TLQVEASQKKSLRAVSPEEMLQGFLNNNSHLDKDCGELILQRGTTKVDAG
LVLNRDRRISWPENSFDFVSKEMFVHSAKSLQASVLMIKALQGYYDVRRA
NDADKAPMHFMVDTLRSTLKERFQFVEVPGNHYIHMNKPQVVAGVVGPFL
QGLQRMTSARL

no DNA




References
3 more
    Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
    Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R and Hayashizaki Y <127 more author(s)>
    Ref: Nature, 420:563, 2002 : PubMed

            

    Title: Functional annotation of a full-length mouse cDNA collection
    Kawai J, Shinagawa A, Shibata K, Yoshino M, Itoh M, Ishii Y, Arakawa T, Hara A, Fukunishi Y and Hayashizaki Y <86 more author(s)>
    Ref: Nature, 409:685, 2001 : PubMed

            

    Title: Identification of Serhl, a new member of the serine hydrolase family induced by passive stretch of skeletal muscle in vivo
    Sadusky TJ, Kemp TJ, Simon M, Carey N, Coulton GR
    Ref: Genomics, 73:38, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer