human-ABHD10

 
Homo sapiens (Human) ABHDA ABHD10 Abhydrolase domain-containing protein 10, Mycophenolic acid acyl-glucuronide esterase, mitochondrial

Relationship
Family ABHD10
Block X
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
>3 Genbank links 5 more: AK002204, BC014516, AL713726
1 UniProt : Q9NUJ1
>3 UniProtTrembl links 1 more: Q9NUJ1, C9IZX5, D3DN63
>3 Interpro links 1 more: Q9NUJ1, C9IZX5, D3DN63
>3 Prodom links 1 more: Q9NUJ1, C9IZX5, D3DN63
>3 Pfam links 1 more: Q9NUJ1, C9IZX5, D3DN63
>3 PIRSF links 1 more: Q9NUJ1, C9IZX5, D3DN63
>3 SUPERFAM links 1 more: Q9NUJ1, C9IZX5, D3DN63
>3 QuickSwissBlast links 1 more: Q9NUJ1, C9IZX5, D3DN63
1 EntrezGene : 55347
1 SNP : 55347
1 UniGene : 477115
1 HUGO HGNC : 25656
1 Ensembl : ENSG00000144827
 
Sequence
Graphical view for this peptide sequence: human-ABHD10
Colored MSA for ABHD10 (raw)
MAVARLAAVAAWVPCRSWGWAAVPFGPHRGLSVLLARIPQRAPRWLPACR
QKTSLSFLNRPDLPNLAYKKLKGKSPGIIFIPGYLSYMNGTKALAIEEFC
KSLGHACIRFDYSGVGSSDGNSEESTLGKWRKDVLSIIDDLADGPQILVG
SSLGGWLMLHAAIARPEKVVALIGVATAADTLVTKFNQLPVELKKEVEMK
GVWSMPSKYSEEGVYNVQYSFIKEAEHHCLLHSPIPVNCPIRLLHGMKDD
IVPWHTSMQVADRVLSTDVDVILRKHSDHRMREKADIQLLVYTIDDLIDK
LSTIVN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAVARLAAVAAWVPCRSWGWAAVPFGPHRGLSVLLARIPQRAPRWLPACR
QKTSLSFLNRPDLPNLAYKKLKGKSPGIIFIPGYLSYMNGTKALAIEEFC
KSLGHACIRFDYSGVGSSDGNSEESTLGKWRKDVLSIIDDLADGPQILVG
SSLGGWLMLHAAIARPEKVVALIGVATAADTLVTKFNQLPVELKKEVEMK
GVWSMPSKYSEEGVYNVQYSFIKEAEHHCLLHSPIPVNCPIRLLHGMKDD
IVPWHTSMQVADRVLSTDVDVILRKHSDHRMREKADIQLLVYTIDDLIDK
LSTIVN

no DNA




References
6 more
    Title: ABHD10 is an S-depalmitoylase affecting redox homeostasis through peroxiredoxin-5
    Cao Y, Qiu T, Kathayat RS, Azizi SA, Thorne AK, Ahn D, Fukata Y, Fukata M, Rice PA, Dickinson BC
    Ref: Nat Chemical Biology, 15:1232, 2019 : PubMed

            

    Title: An Orphan Esterase ABHD10 Modulates Probenecid Acyl Glucuronidation in Human Liver
    Ito Y, Fukami T, Yokoi T, Nakajima M
    Ref: Drug Metabolism & Disposition: The Biological Fate of Chemicals, 42:2109, 2014 : PubMed

            

    Title: Human alpha/beta hydrolase domain containing 10 (ABHD10) is responsible enzyme for deglucuronidation of mycophenolic acid acyl-glucuronide in liver
    Iwamura A, Fukami T, Higuchi R, Nakajima M, Yokoi T
    Ref: Journal of Biological Chemistry, 287:9240, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer