human-ABHD18

 
Homo sapiens (Human) ABHD18 C4orf29 CD029 hypothetical protein

Relationship
Family ABHD18
Block X
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 3 more: AK024759, BC034253, BC128142
>3 UniProt links 3 more: Q0P651, B7WP89, C9K043
>3 UniProtTrembl links 1 more: Q0P651, B7WP89, D6RD85
>3 Interpro links 1 more: Q0P651, B7WP89, D6RD85
>3 Prodom links 1 more: Q0P651, B7WP89, D6RD85
>3 Pfam links 1 more: Q0P651, B7WP89, D6RD85
>3 PIRSF links 1 more: Q0P651, B7WP89, D6RD85
>3 SUPERFAM links 1 more: Q0P651, B7WP89, D6RD85
>3 QuickSwissBlast links 1 more: Q0P651, B7WP89, D6RD85
1 EntrezGene : 80167
1 SNP : 80167
1 UniGene : 445817
1 HUGO HGNC : 26111
1 Ensembl : ENSG00000164074
 
Sequence
Graphical view for this peptide sequence: human-ABHD18
Colored MSA for ABHD18 (raw)
MGVSKLDILYRRLLLTKLFIRGWGRPEDLKRLFEFRKMIGNRERCQNLVS
SDYPVHIDKIEEQSDCKILDGHFVSPMAHYVPDIMPIESVIARFQFIVPK
EWNSKYRPVCIHLAGTGDHHYWRRRTLMARPMIKEARMASLLLENPYYGC
RKPKDQVRSSLKNVSDLFVMGGALVLESAALLHWLEREGYGPLGMTGISM
GGHMASLAVSNWPKPMPLIPCLSWSTASGVFTTGVLSKPINWRELEKQYY
TQTVYEEEIIHMLEYCGTDSFKMGQEFVKHFTSSADKLTNLNLVSRTLNL
DISNQVVSQKPADCHNSSKTSVSATSEGLLLQDTSKMKRFNQTLSTNKSG
YTSRNPQSYHLLSKEQSRNSLRKESLIFMKGVMDECTHVANFSVPVDPSL
IIVVQAKEDAYIPRTGVRSLQEIWPGCEIRYLEGGHISAYLFKQGLFR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGVSKLDILYRRLLLTKLFIRGWGRPEDLKRLFEFRKMIGNRERCQNLVS
SDYPVHIDKIEEQSDCKILDGHFVSPMAHYVPDIMPIESVIARFQFIVPK
EWNSKYRPVCIHLAGTGDHHYWRRRTLMARPMIKEARMASLLLENPYYGC
RKPKDQVRSSLKNVSDLFVMGGALVLESAALLHWLEREGYGPLGMTGISM
GGHMASLAVSNWPKPMPLIPCLSWSTASGVFTTGVLSKPINWRELEKQYY
TQTVYEEEIIHMLEYCGTDSFKMGQEFVKHFTSSADKLTNLNLVSRTLNL
DISNQVVSQKPADCHNSSKTSVSATSEGLLLQDTSKMKRFNQTLSTNKSG
YTSRNPQSYHLLSKEQSRNSLRKESLIFMKGVMDECTHVANFSVPVDPSL
IIVVQAKEDAYIPRTGVRSLQEIWPGCEIRYLEGGHISAYLFKQGLFR

no DNA




References
    Title: Generation and annotation of the DNA sequences of human chromosomes 2 and 4
    Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K and Wilson RK <111 more author(s)>
    Ref: Nature, 434:724, 2005 : PubMed

            

    Title: Complete sequencing and characterization of 21,243 full-length human cDNAs
    Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H and Sugano S <144 more author(s)>
    Ref: Nat Genet, 36:40, 2004 : PubMed

            

    Title: The sequence of the human genome
    Venter JC, Adams MD, Myers EW, Li PW, Mural RJ, Sutton GG, Smith HO, Yandell M, Evans CA and Zhu X <264 more author(s)>
    Ref: Science, 291:1304, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer