human-ABHD1

 
Homo sapiens (Human) lung alpha/beta hydrolase 1

Comment
ABHD1 and Sec12 genes are sense/antisense genes orientated in a tail-to-tail and contain a conserved 42 bp overlap in their 3'UTR, and a conserved polyadenylation signal. No inverse correlation between the levels of ABHD1 and Sec12 RNA was found to indicate that any RNA interference occurred. Predicted fatty acid dependency for both LysoPC and PC lipids, particularly prominent in 14:0 containing phospholipids


Relationship
Block X
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 3 more: AY033290, NM_032604, BC039576
2 UniProt : Q96SE0, C9J8C2
1 Ncbi-nid : 13959788
2 Ncbi-pid : 13959789, NP_115993
2 UniProtTrembl : Q96SE0, C9J8C2
2 Interpro : Q96SE0, C9J8C2
2 Prodom : Q96SE0, C9J8C2
2 Pfam : Q96SE0, C9J8C2
2 PIRSF : Q96SE0, C9J8C2
2 SUPERFAM : Q96SE0, C9J8C2
2 QuickSwissBlast : Q96SE0, C9J8C2
1 EntrezGene : 84696
1 SNP : 84696
1 UniGene : 98608
1 HUGO HGNC : 17553
1 OMIM : 612195
1 Ensembl : ENSG00000143994
 
Sequence
Graphical view for this peptide sequence: human-ABHD1
Colored MSA for abh_upf0017 (raw)
LSSFLSPQNGTWADTFSLLLALAVALYLGYYWACVLQRPRLVAGPQFLAF
LEPHCSITTETFYPTLWCFEGRLQSIFQVLLQSQPLVLYQSDILQTPDGG
QLLLDWAKQPDSSQDPDPTTQPIVLLLPGITGSSQETYVLHLVNQALRDG
YQAVVFNNRGCRGEELRTHRAFCASNTEDLETVVNHIKHRYPQAPLLAVG
ISFGGILVLNHLAQARQAAGLVAALTLSACWDSFETTRSLETPLNSLLFN
QPLTAGLCQLVERNRKVIEKVVDIDFVLQARTIRQFDERYTSVAFGYQDC
VTYYKAASPRTKIDAIRIPVLYLSAADDPFSPVCALPIQAAQHSPYVALL
ITARGGHIGFLEGLLPWQHWYMSRLLHQYAKAIFQDPEGLPDLRALLPSE
DRNS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

LSSFLSPQNGTWADTFSLLLALAVALYLGYYWACVLQRPRLVAGPQFLAF
LEPHCSITTETFYPTLWCFEGRLQSIFQVLLQSQPLVLYQSDILQTPDGG
QLLLDWAKQPDSSQDPDPTTQPIVLLLPGITGSSQETYVLHLVNQALRDG
YQAVVFNNRGCRGEELRTHRAFCASNTEDLETVVNHIKHRYPQAPLLAVG
ISFGGILVLNHLAQARQAAGLVAALTLSACWDSFETTRSLETPLNSLLFN
QPLTAGLCQLVERNRKVIEKVVDIDFVLQARTIRQFDERYTSVAFGYQDC
VTYYKAASPRTKIDAIRIPVLYLSAADDPFSPVCALPIQAAQHSPYVALL
ITARGGHIGFLEGLLPWQHWYMSRLLHQYAKAIFQDPEGLPDLRALLPSE
DRNS

Graphical view for this nucleotide DNA sequence (1371 bp): human-ABHD1



References
4 more
    Title: Complete sequencing and characterization of 21,243 full-length human cDNAs
    Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H and Sugano S <144 more author(s)>
    Ref: Nat Genet, 36:40, 2004 : PubMed

            

    Title: The gene structure and expression of human ABHD1: overlapping polyadenylation signal sequence with Sec12
    Edgar AJ
    Ref: BMC Genomics, 4:18, 2003 : PubMed

            

    Title: LABH-1: cloning of a novel alpha/beta hydrolase fold protein from mouse lung in Proceedings of the Anatomical Society of Great Britain and Ireland
    Edgar AJ, Polak JM
    Ref: Journal of Anatomy, 197:320, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer