Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-CES2

Homo sapiens (Human) carboxylesterase hCE-2,iCE, hiCE, CES2 gene cDNA FLJ76104 Cocaine esterase

Comment
human carboxylesterase iCE gene intestine and liver, Q8IUP4 (Strausberg R.) contains 65 extra amino acid in N-term


Relationship
Family|Carb_B_Chordata
Block| C
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
>3 Genbank links 11 more: AK222724, U60553, D50579
>3 UniProt links 2 more: O00748, Q4G0E9, J3QLP1
3 Ncbi-nid : 1407780, NP_003860, 2058317
3 Ncbi-pid : XP_007873, XP_012498, 2058318
>3 UniProt links 4 more: Q53H57, O00748, Q6IPK9
>3 Interpro links 4 more: Q53H57, O00748, Q6IPK9
>3 Pfam links 4 more: Q53H57, O00748, Q6IPK9
>3 PIRSF links 4 more: Q53H57, O00748, Q6IPK9
>3 SUPERFAM links 4 more: Q53H57, O00748, Q6IPK9
1 EntrezGene : 8824
1 SNP : 8824
1 HUGO HGNC : 1864
1 OMIM : 605278
1 Ensembl : ENSG00000172831
Sequence
Graphical view for this peptide sequence: human-CES2
Colored MSA for Carb_B_Chordata (raw)
MRLHRLRARLSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKG
ANAGVQTFLGIPFAKPPLGPLRFAPPEPPESWSGVRDGTTHPAMCLQDLT
AVESEFLSQFNMTFPSDSMSEDCLYLSIYTPAHSHEGSNLPVMVWIHGGA
LVFGMASLYDGSMLAALENVVVVIIQYRLGVLGFFSTGDKHATGNWGYLD
QVAALRWVQQNIAHFGGNPDRVTIFGESAGGTSVSSLVVSPISQGLFHGA
IMESGVALLPGLIASSADVISTVVANLSACDQVDSEALVGCLRGKSKEEI
LAINKPFKMIPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLI
PKVMRIYDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDP
QTLQAQFQEMMADSMFVIPALQVAHFQCSRAPVYFYEFQHQPSWLKNIRP
PHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLSRKMMKYWANFARNGNP
NGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELE
EPEERHTEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRLHRLRARLSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKG
ANAGVQTFLGIPFAKPPLGPLRFAPPEPPESWSGVRDGTTHPAMCLQDLT
AVESEFLSQFNMTFPSDSMSEDCLYLSIYTPAHSHEGSNLPVMVWIHGGA
LVFGMASLYDGSMLAALENVVVVIIQYRLGVLGFFSTGDKHATGNWGYLD
QVAALRWVQQNIAHFGGNPDRVTIFGESAGGTSVSSLVVSPISQGLFHGA
IMESGVALLPGLIASSADVISTVVANLSACDQVDSEALVGCLRGKSKEEI
LAINKPFKMIPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLI
PKVMRIYDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDP
QTLQAQFQEMMADSMFVIPALQVAHFQCSRAPVYFYEFQHQPSWLKNIRP
PHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLSRKMMKYWANFARNGNP
NGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELE
EPEERHTEL


References
43 more
    Title: Rationally Engineered hCES2A Near-Infrared Fluorogenic Substrate for Functional Imaging and High-Throughput Inhibitor Screening
    Fan Y, Zhang T, Song Y, Sang Z, Zeng H, Liu P, Wang P, Ge G
    Ref: Analytical Chemistry, 95:15665-15672, 2023 : PubMed

            

    Title: Design, synthesis, and biological evaluation studies of novel carboxylesterase 2 inhibitors for the treatment of irinotecan-induced delayed diarrhea
    Yang Z, Cao Z, Wang W, Chen Y, Huang W, Jiao S, Chen S, Chen L, Liu Y and Li Z <2 more author(s)>
    Ref: Bioorg Chem, 138:106625, 2023 : PubMed

            

    Title: Carboxylesterase 2 proteins are efficient diglyceride and monoglyceride lipases possibly implicated in metabolic disease
    Chalhoub G, Kolleritsch S, Maresch LK, Taschler U, Pajed L, Tilp A, Natmessnig H, Rosina P, Kien B and Haemmerle G <4 more author(s)>
    Ref: J Lipid Res, :100075, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer