human-KANSL3

 
Homo sapiens (Human) KAT8 regulatory NSL complex subunit 3, Testis development protein PRTD, KIAA1310, PRTD, SI1, FLJ10081, NSL3, Rcd1

Comment
Old K1310_HUMAN human-Q86T19 only central part Pfam A Abhydrolase_5 289 436


Relationship
Family NLS3-Tex30
Block X
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 13 more: BC051763, AK023813, AK000943
>3 UniProt links 7 more: Q9P2N6, B4DYX5, B4E1W4
>3 UniProtTrembl links 6 more: Q9P2N6, B4DYX5, B4E1W4
>3 Interpro links 6 more: Q9P2N6, B4DYX5, B4E1W4
>3 Prodom links 6 more: Q9P2N6, B4DYX5, B4E1W4
>3 Pfam links 6 more: Q9P2N6, B4DYX5, B4E1W4
>3 PIRSF links 6 more: Q9P2N6, B4DYX5, B4E1W4
>3 SUPERFAM links 6 more: Q9P2N6, B4DYX5, B4E1W4
>3 QuickSwissBlast links 6 more: Q9P2N6, B4DYX5, B4E1W4
1 EntrezGene : 55683
1 SNP : 55683
1 UniGene : 516341
1 HUGO HGNC : 25473
1 Ensembl : ENSG00000114982
 
Sequence
Graphical view for this peptide sequence: human-KANSL3
Colored MSA for NLS3-Tex30 (raw)
NKPSKLPGSPLILIASSGPSSSVFPTSRRHRFWQSQLSCLGKVIPVATHL
LNNGSGVGVLQCLEHMIGAVRSKVLEIHSHFPHKPIILIGWNTGALVACH
VSVMEYVTAVVCLGFPLLTVDGPRGDVDDPLLDMKTPVLFVIGQNSLQCH
PEAMEDFREKIRAENSLVVVGGADDNLRISKAKKKSEGLTQSMVDRCIQD
EIVDFLTGVLTRA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

NKPSKLPGSPLILIASSGPSSSVFPTSRRHRFWQSQLSCLGKVIPVATHL
LNNGSGVGVLQCLEHMIGAVRSKVLEIHSHFPHKPIILIGWNTGALVACH
VSVMEYVTAVVCLGFPLLTVDGPRGDVDDPLLDMKTPVLFVIGQNSLQCH
PEAMEDFREKIRAENSLVVVGGADDNLRISKAKKKSEGLTQSMVDRCIQD
EIVDFLTGVLTRA

no DNA




References
8 more
    Title: An epigenetic regulator emerges as microtubule minus-end binding and stabilizing factor in mitosis
    Meunier S, Shvedunova M, Van Nguyen N, Avila L, Vernos I, Akhtar A
    Ref: Nat Commun, 6:7889, 2015 : PubMed

            

    Title: Subunit composition and substrate specificity of a MOF-containing histone acetyltransferase distinct from the male-specific lethal (MSL) complex
    Cai Y, Jin J, Swanson SK, Cole MD, Choi SH, Florens L, Washburn MP, Conaway JW, Conaway RC
    Ref: Journal of Biological Chemistry, 285:4268, 2010 : PubMed

            

    Title: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach
    Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S
    Ref: Analytical Chemistry, 81:4493, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer