human-NLGN4X

 
Homo sapiens (Human) Neuroligin-4, X-linked (HNLX) Neuroligin4 KIAA0951

Comment
Neuronal cell surface protein involved in cell-cell-interactions. Homodimer. Interacts with NRXN1 in a calcium-dependent manner. Interacts through its C-terminus with DLG4/PSD-95 third PDZ domain. In fact Neuroligin4 is neuroligin X on chromosome X a new entry neuroligin 4Y neuroligin Y is created human-neurxx LOC59203 mRNA in fact identical to 4neur is suppressed Neuroligin4 mutated in AUTISM, X-LINKED see Jamain et al, Laumonnier et al, Yan et al. see mutation


Relationship
Family Neuroligin
Block C
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
8 mutations: Table (ordered Natural and SD mutagenesis) (e.g. : 445kbdel_human-NLGN4X, fs1186T_human-NLGN4X, del1254AG_human-NLGN4X ... more)
3 structures: 2WQZ, 2XB6, 3BE8
No kinetic
Disease: Neuroligin 4 Autism AUTSX2 Asperger syndrome ASPGX2 -


>3 Genbank links 11 more: AB033086, BAA86574, AF376803
>3 UniProt links 3 more: Q8N0W4, A8K4S1, B3KMT6
2 Ncbi-nid : 4589546, 10869783
>3 Ncbi-pid links 5 more: NP_055708, XP_000568, XP_000619
3 Structure : 2WQZ, 2XB6, 3BE8
>3 UniProtTrembl links 3 more: Q8N0W4, A8K4S1, B3KMT6
>3 Interpro links 3 more: Q8N0W4, A8K4S1, B3KMT6
>3 Prodom links 3 more: Q8N0W4, A8K4S1, B3KMT6
>3 Pfam links 3 more: Q8N0W4, A8K4S1, B3KMT6
>3 PIRSF links 3 more: Q8N0W4, A8K4S1, B3KMT6
>3 SUPERFAM links 3 more: Q8N0W4, A8K4S1, B3KMT6
>3 QuickSwissBlast links 3 more: Q8N0W4, A8K4S1, B3KMT6
1 EntrezGene : 57502
1 SNP : 57502
1 UniGene : 21107
1 HUGO HGNC : 14287
>3 OMIM links 1 more: 300427, 608638, 300497
1 Ensembl : ENSG00000146938
 
Sequence
Graphical view for this peptide sequence: human-NLGN4X
Colored MSA for Neuroligin (raw)
MSRPQGLLWLPLLFTPVCVMLNSNVLLWLTALAIKFTLIDSQAQYPVVNT
NYGKIRGLRTPLPNEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGI
RNTTQFAAVCPQHLDERSLLHDMLPIWFTANLDTLMTYVQDQNEDCLYLN
IYVPTEDDIHDQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVIT
INYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTI
FGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRIL
ADKVGCNMLDTTDMVECLRNKNYKELIQQTITPATYHIAFGPVIDGDVIP
DDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFSVS
NFVDNLYGYPEGKDTLRETIKFMYTDWADKENPETRRKTLVALFTDHQWV
APAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWADSAHGDEVPYVFGIP
MIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTK
PNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNL
NEIFQYVSTTTKVPPPDMTSFPYGTRRSPAKIWPTTKRPAITPANNPKHS
KDPHKTGPEDTTVLIETKRDYSTELSVTIAVGASLLFLNILAFAALYYKK
DKRRHETHRRPSPQRNTTNDIAHIQNEEIMSLQMKQLEHDHECESLQAHD
TLRLTCPPDYTLTLRRSPDDIPLMTPNTITMIPNTLTGMQPLHTFNTFSG
GQNSTNLPHGHSTTRV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSRPQGLLWLPLLFTPVCVMLNSNVLLWLTALAIKFTLIDSQAQYPVVNT
NYGKIRGLRTPLPNEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGI
RNTTQFAAVCPQHLDERSLLHDMLPIWFTANLDTLMTYVQDQNEDCLYLN
IYVPTEDDIHDQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVIT
INYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTI
FGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRIL
ADKVGCNMLDTTDMVECLRNKNYKELIQQTITPATYHIAFGPVIDGDVIP
DDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFSVS
NFVDNLYGYPEGKDTLRETIKFMYTDWADKENPETRRKTLVALFTDHQWV
APAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWADSAHGDEVPYVFGIP
MIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTK
PNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNL
NEIFQYVSTTTKVPPPDMTSFPYGTRRSPAKIWPTTKRPAITPANNPKHS
KDPHKTGPEDTTVLIETKRDYSTELSVTIAVGASLLFLNILAFAALYYKK
DKRRHETHRRPSPQRNTTNDIAHIQNEEIMSLQMKQLEHDHECESLQAHD
TLRLTCPPDYTLTLRRSPDDIPLMTPNTITMIPNTLTGMQPLHTFNTFSG
GQNSTNLPHGHSTTRV

Graphical view for this nucleotide DNA sequence (5048 bp): human-NLGN4X



References
26 more
    Title: Elevated plasma X-linked neuroligin 4 expression is associated with autism spectrum disorder
    Alayadhi LY, Qasem H, Alghamdi HAM, Elamin NE
    Ref: Med Princ Pract, :, 2020 : PubMed

            

    Title: Neuroligin 4X overexpression in human breast cancer is associated with poor relapse-free survival
    Henderson HJ, Karanam B, Samant R, Vig K, Singh SR, Yates C, Bedi D
    Ref: PLoS ONE, 12:e0189662, 2017 : PubMed

            

    Title: Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro
    Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O
    Ref: DNA Research, 6:63, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer