human-BCHE

 
Homo sapiens (Human) butyrylcholinesterase

Comment
Acylcholine acylhydrolase, Butyrylcholine esterase, Choline esterase II, Pseudocholinesterase. Esterase with broad substrate specificity. Contributes to the inactivation of the neurotransmitter acetylcholine. Can degrade neurotoxic organophosphate esters. BChE deficiency is a metabolic disorder characterized by prolonged apnoea after the use of certain anesthetic drugs, including the muscle relaxants succinylcholine or mivacurium and other ester local anesthetics.Various autosomal recessive mutations of the gene exist in human population Another short contig contains a little bit of the gene AC069210.7.15194.32648 Cterminus T peptide


Relationship
Family BCHE
Block C
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
273 mutations: Table (ordered Natural and SD mutagenesis) (e.g. : K339M, W430A, N83A ... more)
90 structures (e.g. : 8AM1, 8AM2, 7ZPB... more)
Kinetic: human-BCHE

Substrate: 2,6-Dichlorophenolindophenyl-acetate , AND-logic-probe-P2 , Idalopirdine-rivastigmine , Methyl-4-piperidinyl-N-benzoate , [I125]Methyl-4-piperidinyl-N-benzoate , Methyl-4-piperidinyl-N-butyrate , CurDD , N-Methylindoxyl-acetate , Benzoylecgonine , Irinotecan , 1-Naphtylacetate , Acetylcholine , Acetylthiocholine , Isosorbide-2-aspirinate-5-salicylate , Aspirin , Bambuterol , Benzoylcholine , Butyrylcholine , Butyrylthiocholine , Cocaine , Heroin , Procaine , Propionylcholine , Propionylthiocholine , Succinylcholine~Suxamethonium , Succinyldithiocholine , Tetracaine , Benzoylthiocholine , Monocaprin , Octanoyl-ghrelin ,
Inhibitor: S11-1014 , Coumarin-Pyridine-3f , 6H6-Heptyl-Carbamate , Cpd20-Benzimidazol-Oxadiazol , Difluorophenyl-pyridin-piperazin-1,3,4-oxadiazole-49 , 5-pyrid-3-yl-1,3,4-oxadiazole-5e , Salicylamide-8-Tacrine , IA4-7BO3 , A87-7BO4 , MT-031 , 8U2-7AIX7AY-compound5i , CBD-carbamate-C16 , PE154 , S06-1011 , Idalopirdine-rivastigmine , Tacrine-methylanacardate-cpd5 , MTDL-cpd51-diphenylacetamide , MTDL-cpd36-diphenylacetamide , Ass-IN-10 , 1,9-dimethyl-methylene-blue , 6ZWE-Cpd3 , CHEMBL4454960 , CHEMBL4454960-PET , Tosyl-L-lysine-chloromethyl-ketone , ZINC20166201-cpd8 , 8012-9656 , 6SAM-cpd13 , Goodyschle-A , 6QAD-HUZ , 6XTA-cpd18 , 6QAE-HUK , 6QAC-HUT , 6QAB-HUQ , 6QAA-HUN , 6RUA-3a , JU5 , JUB , 6F7Q-cpd11 , Chlorotacrine-tryptophan-hybrid , PGN33 , 5LKR-6yc , 5DYT-5hb , 5DYY-5hh , DL0410 , 5DYW-5hf-C11 , 5DYW-5hf-F , 5DYW-5hf , 5NN0-cpd3 , Malachite-Green , ST052207 , Hup-19 , Thioflavin-T , Aroylacrylic-acid-amide-Tacrine-10 , 40V , 3F9 , CBDP , Choline , Cocaine , Decamethonium , DFP , Echothiophate , Ethopropazine , Fluoride , Toluidine-Blue , Propidium , Pyridostigmine , Sarin , Soman , Tacrine , Chinese-VX , Russian-VX , VX , Isosorbide-2-benzylcarbamate-5-benzyl-ether , Isosorbide-2-benzylcarbamate-5-benzoate , Isosorbide-2-benzylcarbamate-5-salicylate ,
>3 Genbank links 11 more: AAA99296, M16541, M32391
>3 UniProt links 5 more: P06276, D3DNN4, F8WEX7
1 Ncbi-nid : 1280204
1 Ncbi-pid : 180484
>3 Structure links 87 more: 8AM1, 8AM2, 7ZPB
>3 UniProtTrembl links 6 more: P06276, Q96HL2, D3DNN4
>3 Interpro links 6 more: P06276, Q96HL2, D3DNN4
>3 Prodom links 6 more: P06276, Q96HL2, D3DNN4
>3 Pfam links 6 more: P06276, Q96HL2, D3DNN4
>3 PIRSF links 6 more: P06276, Q96HL2, D3DNN4
>3 SUPERFAM links 6 more: P06276, Q96HL2, D3DNN4
>3 QuickSwissBlast links 6 more: P06276, Q96HL2, D3DNN4
1 EntrezGene : 590
1 SNP : 590
1 UniGene : 420483
1 HUGO HGNC : 983
1 IUPHAR : 2471
3 OMIM : 177400, 177500, 177600
1 Ensembl : ENSG00000114200
 
Sequence
Graphical view for this peptide sequence: human-BCHE
Colored MSA for BCHE (raw)
EDDIIIATKNGKVRGMNLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLT
KWSDIWNATKYANSCCQNIDQSFPGFHGSEMWNPNTDLSEDCLYLNVWIP
APKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGA
LGFLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAG
AASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLT
GCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVDGDFLT
DMPDILLELGQFKKTQILVGVNKDEGTAFLVYGAPGFSKDNNSIITRKEF
QEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDVVGDYNFIC
PALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPL
ERRDNYTKAEEILSRSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKY
LTLNTESTRIMTKLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRW
NNYMMDWKNQFNDYTSKKESCVGL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

EDDIIIATKNGKVRGMNLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLT
KWSDIWNATKYANSCCQNIDQSFPGFHGSEMWNPNTDLSEDCLYLNVWIP
APKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGA
LGFLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAG
AASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLT
GCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVDGDFLT
DMPDILLELGQFKKTQILVGVNKDEGTAFLVYGAPGFSKDNNSIITRKEF
QEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDVVGDYNFIC
PALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPL
ERRDNYTKAEEILSRSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKY
LTLNTESTRIMTKLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRW
NNYMMDWKNQFNDYTSKKESCVGL

Graphical view for this nucleotide DNA sequence (2260 bp): human-BCHE



References
34 more
    Title: From tryptophan-based amides to tertiary amines: Optimization of a butyrylcholinesterase inhibitor series
    Meden A, Knez D, Brazzolotto X, Nachon F, Dias J, Svete J, Stojan J, Groselj U, Gobec S
    Ref: Eur Journal of Medicinal Chemistry, 230:114248, 2022 : PubMed

            

    Title: N-alkylpiperidine carbamates as potential anti-Alzheimer's agents
    Kosak U, Strasek N, Knez N, Jukic M, Zakelj S, Zahirovic A, Pislar A, Brazzolotto X, Nachon F and Knez D <2 more author(s)>
    Ref: Eur Journal of Medicinal Chemistry, 197:112282, 2020 : PubMed

            

    Title: Rivastigmine and metabolite analogues with putative Alzheimer's disease-modifying properties in a Caenorhabditis elegans model.
    Dighe SN, De la Mora E, Chan S, Kantham S, McColl G, Miles JA, Veliyath SK, Sreenivas BY, Nassar ZD and Ross BP <6 more author(s)>
    Ref: Communications chemistry, 2:35, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer